Lus10006091 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025243 130 / 6e-41 ND 35 / 9e-04
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G134100 56 / 1e-11 ND /
PFAM info
Representative CDS sequence
>Lus10006091 pacid=23174787 polypeptide=Lus10006091 locus=Lus10006091.g ID=Lus10006091.BGIv1.0 annot-version=v1.0
ATGGGATCTTGCAAAATCAACAGAGCGTTGATAACGGCGGTGGCGATCCTGGTGATTCTAATGTGTCAAAGTTCATCAGCTAGGTTACTCTGCGGTTCTT
TCCCGGAAGTTGGGGCATCACTGTCGTCGGCTGGAATTGCTCTGCCGATGGAGCAGAAGAACAAGATGGGAAGAGAGGGATCAGTTGTAACTGCTGGTGG
TACAAAGGACAAGAACGACTACTACTACAAGTCACTGTTGCTTAATGTTCTGCCTAAGGGTAGTCGGGCACCATCAGGGCCAAGCAAGAGGACCAACAGC
CTCGTCAATTAA
AA sequence
>Lus10006091 pacid=23174787 polypeptide=Lus10006091 locus=Lus10006091.g ID=Lus10006091.BGIv1.0 annot-version=v1.0
MGSCKINRALITAVAILVILMCQSSSARLLCGSFPEVGASLSSAGIALPMEQKNKMGREGSVVTAGGTKDKNDYYYKSLLLNVLPKGSRAPSGPSKRTNS
LVN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10006091 0 1
AT1G17420 ATLOX3, LOX3 Arabidopsis thaliana lipoxygen... Lus10013151 1.4 0.9650
AT3G54100 O-fucosyltransferase family pr... Lus10021119 1.7 0.9661
AT5G17540 HXXXD-type acyl-transferase fa... Lus10020331 2.0 0.9552
Lus10039474 2.2 0.9520
AT2G37980 O-fucosyltransferase family pr... Lus10017190 2.4 0.9595
Lus10025243 3.5 0.9494
AT2G27310 F-box family protein (.1) Lus10013309 4.2 0.9359
AT1G70520 ASG6, CRK2 ALTERED SEED GERMINATION 6, cy... Lus10013039 7.2 0.9313
AT2G33480 NAC ANAC041 NAC domain containing protein ... Lus10041534 7.2 0.9053
AT3G18710 ATPUB29 ARABIDOPSIS THALIANA PLANT U-B... Lus10042798 7.4 0.9336

Lus10006091 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.