Lus10006114 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G59650 204 / 2e-69 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010559 249 / 2e-87 AT3G59650 201 / 2e-68 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2)
Lus10022178 170 / 3e-52 AT3G59650 138 / 2e-39 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G126200 195 / 7e-66 AT3G59650 202 / 8e-69 mitochondrial ribosomal protein L51/S25/CI-B8 family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF05047 L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
Representative CDS sequence
>Lus10006114 pacid=23174789 polypeptide=Lus10006114 locus=Lus10006114.g ID=Lus10006114.BGIv1.0 annot-version=v1.0
ATGGCCTTACGAGGCGTTTGGCAGCTGAAAAAGCTGGTTGTGAGCTACAGTGATTGGGGTGGAAGTAGCAGGGGGATCAGGGCATTCATGGAGTCGCACC
TCCCAACATTGAAAGCTGAGAATCCCCATCTGAAGGTGGAAACTGAACTGATTCGAGGCCAACACCCGCACTTAAAGGCCTTTTACAAAAACAACAATGA
AAGAGTGGTATGCGTGAGGAACATGACCCCAGATGAAGTATTACTGCATGCTACCAGGCTAAGGAATGCATTGGGAAGAAAGGTGGTAAAACTGAAGACA
AGACACGTTACCAAACACCCAAGTGTACAAGGTACATGGACAACGGGGCTGAAATTTGAGGAGGCATGA
AA sequence
>Lus10006114 pacid=23174789 polypeptide=Lus10006114 locus=Lus10006114.g ID=Lus10006114.BGIv1.0 annot-version=v1.0
MALRGVWQLKKLVVSYSDWGGSSRGIRAFMESHLPTLKAENPHLKVETELIRGQHPHLKAFYKNNNERVVCVRNMTPDEVLLHATRLRNALGRKVVKLKT
RHVTKHPSVQGTWTTGLKFEEA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G59650 mitochondrial ribosomal protei... Lus10006114 0 1
AT3G12390 Nascent polypeptide-associated... Lus10026133 1.0 0.9005
AT5G46920 Intron maturase, type II famil... Lus10003019 2.2 0.8573
AT4G30220 RUXF small nuclear ribonucleoprotei... Lus10006867 2.4 0.8860
AT4G30220 RUXF small nuclear ribonucleoprotei... Lus10037606 2.8 0.8936
AT1G11240 unknown protein Lus10018438 4.0 0.8830
AT5G09270 unknown protein Lus10004877 5.2 0.8331
AT5G38890 Nucleic acid-binding, OB-fold-... Lus10004763 6.5 0.8466
AT1G07950 MED22B Surfeit locus protein 5 subuni... Lus10023466 10.6 0.8357
AT2G20490 NOP10, EDA27 EMBRYO SAC DEVELOPMENT ARREST ... Lus10033907 11.0 0.8164
AT3G07640 unknown protein Lus10041098 14.3 0.7770

Lus10006114 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.