Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35580 97 / 7e-25 NAC NTL9, CBNAC NAC transcription factor-like 9 (.1.2.3) AT1G33060 97 / 1e-24 NAC ANAC014 NAC 014 (.1.2) AT5G24590 87 / 5e-21 NAC TIP, ANAC091 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) AT3G49530 84 / 4e-20 NAC NTL6, ANAC062 NTM1 \(NAC WITH TRANSMEMBRANE MOTIF 1\)-LIKE 6, NAC domain containing protein 62 (.1) AT5G17260 73 / 3e-16 NAC ANAC086 NAC domain containing protein 86 (.1) AT1G65910 72 / 8e-16 NAC ANAC028 NAC domain containing protein 28 (.1) AT3G03200 69 / 7e-15 NAC ANAC045 NAC domain containing protein 45 (.1) AT1G54330 68 / 1e-14 NAC ANAC020 NAC domain containing protein 20 (.1) AT3G17730 67 / 1e-14 NAC ANAC057 NAC domain containing protein 57 (.1) AT5G04400 67 / 2e-14 NAC ANAC077 NAC domain containing protein 77 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026588 [exp] 203 / 2e-69 AT4G35580 101 / 3e-26 NAC transcription factor-like 9 (.1.2.3) Lus10010148 [exp] 116 / 2e-31 AT4G35580 325 / 9e-105 NAC transcription factor-like 9 (.1.2.3) Lus10033251 [exp] 102 / 1e-26 AT4G35580 410 / 5e-138 NAC transcription factor-like 9 (.1.2.3) Lus10013721 [exp] 99 / 1e-26 AT5G09760 278 / 3e-91 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10008285 [exp] 102 / 2e-26 AT4G35580 421 / 2e-142 NAC transcription factor-like 9 (.1.2.3) Lus10037285 [exp] 87 / 4e-21 AT4G19180 871 / 0.0 GDA1/CD39 nucleoside phosphatase family protein (.1) Lus10015587 [exp] 82 / 2e-19 AT5G24590 306 / 9e-99 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Lus10032919 [exp] 82 / 3e-19 AT5G24590 314 / 7e-102 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Lus10020794 [exp] 71 / 2e-15 AT5G10360 449 / 8e-153 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G452700 [exp] 100 / 6e-26 AT1G33060 415 / 7e-137 NAC 014 (.1.2) Potri.011G149300 [exp] 100 / 8e-26 AT1G33060 387 / 2e-125 NAC 014 (.1.2) Potri.012G007500 [exp] 84 / 6e-20 AT5G24590 306 / 4e-98 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Potri.015G004100 [exp] 81 / 6e-19 AT3G49530 309 / 5e-99 NTM1 \(NAC WITH TRANSMEMBRANE MOTIF 1\)-LIKE 6, NAC domain containing protein 62 (.1) Potri.010G174600 [exp] 70 / 3e-15 AT1G54330 290 / 2e-97 NAC domain containing protein 20 (.1) Potri.002G182300 [exp] 68 / 6e-15 AT4G35580 184 / 4e-55 NAC transcription factor-like 9 (.1.2.3) Potri.002G182000 [exp] 68 / 8e-15 AT4G35580 186 / 9e-56 NAC transcription factor-like 9 (.1.2.3) Potri.008G081500 [exp] 69 / 9e-15 AT1G54330 316 / 1e-107 NAC domain containing protein 20 (.1) Potri.004G081000 [exp] 69 / 9e-15 AT1G65910 465 / 4e-156 NAC domain containing protein 28 (.1) Potri.002G154200 [exp] 67 / 9e-15 AT4G35580 169 / 5e-50 NAC transcription factor-like 9 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10006119 pacid=23174758 polypeptide=Lus10006119 locus=Lus10006119.g ID=Lus10006119.BGIv1.0 annot-version=v1.0 ATGTCGGCTCTGGCGGTGAAGTCGCTTCCACTGGGATACCGATTCCAGCCAACTGACGAGGAGCTCATCACTCACTACCTCAGGTTGAAGATCAACGGCC GCGATTCCGAAGTCGACGCCGTTCCTGAAATCGACGTCTGCAGATGGGAGCCTTGGGATCTTCCCGCTCAAGTTTATACAATCGACGAGAAGGAAAATGA CAAGACAAGGAGAATCAAAATCTCTGCAAACATTGCAGGTCTGGAAATGTTTGCAGGTCTGGAAATGTTGTTACTGAATTCTCAGGAGCTGGATTGCCAG CTGCGAGGTTGTTATCCATTTGGTCGGAACGGCGTCGTGTAG
AA sequence Show only first row Show all	>Lus10006119 pacid=23174758 polypeptide=Lus10006119 locus=Lus10006119.g ID=Lus10006119.BGIv1.0 annot-version=v1.0 MSALAVKSLPLGYRFQPTDEELITHYLRLKINGRDSEVDAVPEIDVCRWEPWDLPAQVYTIDEKENDKTRRIKISANIAGLEMFAGLEMLLLNSQELDCQ LRGCYPFGRNGVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10006119 [exp]	0	1
AT5G46030			unknown protein		Lus10014995 [exp]	3.6	0.9137
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10016178 [exp]	4.6	0.9578
AT2G38870			Serine protease inhibitor, pot...		Lus10018783 [exp]	12.3	0.9412
AT3G15980			Coatomer, beta' subunit (.1.2....		Lus10026094 [exp]	13.1	0.9397
AT2G42350			RING/U-box superfamily protein...		Lus10005104 [exp]	13.9	0.9398
AT2G27410	B3		Domain of unknown function (DU...		Lus10027286 [exp]	17.9	0.9196
AT5G40690			unknown protein		Lus10015261 [exp]	20.4	0.9090
AT2G29100		ATGLR2.9	GLUTAMATE RECEPTOR 2.9, gluta...		Lus10025427 [exp]	22.0	0.9175
AT2G19070		SHT	spermidine hydroxycinnamoyl tr...		Lus10005358 [exp]	22.1	0.9291
AT1G31720			Protein of unknown function (D...		Lus10034746 [exp]	22.6	0.8869

Compare expression of checked genes

Lus10006119 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.