Lus10006122 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32090 199 / 4e-67 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
AT2G28420 64 / 1e-13 GLYI8 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
AT1G80160 50 / 2e-08 GLYI7 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
AT1G15380 49 / 5e-08 GLYI4 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010552 282 / 9e-100 AT2G32090 197 / 3e-66 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10039579 58 / 6e-11 AT2G28420 248 / 2e-84 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10005324 55 / 8e-10 AT2G28420 245 / 2e-83 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10030070 47 / 7e-07 AT1G80160 247 / 7e-85 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10014480 46 / 8e-07 AT1G80160 244 / 1e-83 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10025971 44 / 5e-06 AT1G15380 165 / 3e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10014269 44 / 1e-05 AT1G15380 166 / 2e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G087000 217 / 5e-74 AT2G32090 189 / 3e-63 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.008G153602 156 / 2e-49 AT2G32090 139 / 8e-43 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.009G055500 59 / 1e-11 AT2G28420 229 / 1e-77 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Potri.001G171600 52 / 6e-09 AT1G80160 270 / 6e-94 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.003G009000 51 / 2e-08 AT1G80160 190 / 8e-62 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.003G062400 50 / 4e-08 AT1G80160 261 / 2e-90 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.004G223300 50 / 4e-08 AT1G80160 187 / 1e-60 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.007G015100 47 / 7e-07 AT1G15380 167 / 7e-53 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.005G117000 45 / 3e-06 AT1G80160 166 / 2e-52 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.007G129200 41 / 4e-05 AT1G80160 225 / 1e-76 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0104 Glyoxalase PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Representative CDS sequence
>Lus10006122 pacid=23174766 polypeptide=Lus10006122 locus=Lus10006122.g ID=Lus10006122.BGIv1.0 annot-version=v1.0
ATGGCGGCAGCCTCGGCACCTATTCTCAGCCACATCGCCAGAGAATCCACAGACATTAGACGCCTGGCCAATTTCTACAAGGAGATCTTTGGGTTTGAGG
AGATCGAGACTCCCGATTTTGGATTCAACGTGATATGGCTGAATCTGGCGAATGCTTTCTCTTTCCACCTCATTGAGAGGAGCCCCGAGACCAAGCTTCC
AGAAGGACCTTACAGTGCTTCAGAGCCGATTCGCGATGTCACCCATCTCGCCAGAGGCCATCATATCTGTATCTCCGTCGCCAACTTCGACGCTTTTGTT
CAATCTCTAAAGGAGAAAGGGATAGAGACGTTCCAGAGGGCAGTTCCTGGTCGGTCAATTAGGCAAGTTTTCTTCTTTGATCCAGATGGCAATGGACTGG
AGGTGGCAAGTCGGGATGAGTAG
AA sequence
>Lus10006122 pacid=23174766 polypeptide=Lus10006122 locus=Lus10006122.g ID=Lus10006122.BGIv1.0 annot-version=v1.0
MAAASAPILSHIARESTDIRRLANFYKEIFGFEEIETPDFGFNVIWLNLANAFSFHLIERSPETKLPEGPYSASEPIRDVTHLARGHHICISVANFDAFV
QSLKEKGIETFQRAVPGRSIRQVFFFDPDGNGLEVASRDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32090 Lactoylglutathione lyase / gly... Lus10006122 0 1
AT4G10330 glycine-rich protein (.1) Lus10001357 1.4 0.9609
AT1G58030 CAT2 cationic amino acid transporte... Lus10001334 5.1 0.9586
AT4G27130 Translation initiation factor ... Lus10027181 5.5 0.9516
AT5G44250 Protein of unknown function DU... Lus10042660 5.7 0.9573
AT4G15940 Fumarylacetoacetate (FAA) hydr... Lus10006496 6.2 0.9404
AT4G27130 Translation initiation factor ... Lus10015124 6.7 0.9436
AT3G07580 unknown protein Lus10016076 7.4 0.9517
AT4G31130 Protein of unknown function (D... Lus10026052 9.6 0.9317
AT3G51730 saposin B domain-containing pr... Lus10025248 10.4 0.9519
AT1G68300 Adenine nucleotide alpha hydro... Lus10034337 13.0 0.9292

Lus10006122 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.