Lus10006139 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23780 62 / 2e-12 F-box family protein (.1)
AT1G23770 54 / 1e-09 F-box family protein (.1)
AT1G70360 50 / 9e-09 F-box family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012441 86 / 5e-21 AT1G23780 215 / 3e-63 F-box family protein (.1)
Lus10033762 83 / 8e-20 AT1G23780 199 / 4e-57 F-box family protein (.1)
Lus10011411 74 / 8e-17 AT1G23770 110 / 5e-28 F-box family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G109700 82 / 2e-19 AT1G23780 244 / 2e-74 F-box family protein (.1)
Potri.015G020600 69 / 3e-15 AT1G23780 0 / 1 F-box family protein (.1)
Potri.017G134500 0 / 1 AT1G23780 0 / 1 F-box family protein (.1)
PFAM info
Representative CDS sequence
>Lus10006139 pacid=23176727 polypeptide=Lus10006139 locus=Lus10006139.g ID=Lus10006139.BGIv1.0 annot-version=v1.0
ATGGCTGGTTTATCACTGCCTCCATGTTTTATGACCCTGCCTGCTGATACAAAGACCAGCATCTTGAAGTTCCTACCGGGGGTTAGTACAGCGAGAATGG
AATGCGTCTCGTCGGAGATGTGGCATCTTTCGTCACACAACGATGCATTATGGAGGCAGAAGTTTATAGAAGAGTTCGGAAGTGAGGTGGACACTGATTT
GGCTGCCGCAAACTGGAAGGGGGTTTTGCTTCCCAAGTGGAGCTCACCAAAAAACGCAGAACAGGCTTTTGCATCTTCGAGTAGGAACAATGATGGCGGC
TTTCTCAGATAA
AA sequence
>Lus10006139 pacid=23176727 polypeptide=Lus10006139 locus=Lus10006139.g ID=Lus10006139.BGIv1.0 annot-version=v1.0
MAGLSLPPCFMTLPADTKTSILKFLPGVSTARMECVSSEMWHLSSHNDALWRQKFIEEFGSEVDTDLAAANWKGVLLPKWSSPKNAEQAFASSSRNNDGG
FLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G23780 F-box family protein (.1) Lus10006139 0 1
AT3G61800 unknown protein Lus10004000 3.0 0.9052
AT5G04410 NAC NAC2, ANAC078 Arabidopsis NAC domain contain... Lus10032724 3.2 0.9030
AT1G23770 F-box family protein (.1) Lus10006138 3.2 0.8601
AT4G38260 Protein of unknown function (D... Lus10013833 12.7 0.7977
AT3G17700 ATCNGC20, CNBT1 CYCLIC NUCLEOTIDE-GATED CHANNE... Lus10031891 13.4 0.8741
AT4G13980 HSF AT-HSFA5 HEAT SHOCK TRANSCRIPTION FACTO... Lus10022546 17.3 0.8579
AT1G07570 APK1A Protein kinase superfamily pro... Lus10002697 19.2 0.8947
AT1G58170 Disease resistance-responsive ... Lus10018340 20.9 0.8417
AT1G55850 ATCSLE1 cellulose synthase like E1 (.1... Lus10016625 23.2 0.8860
AT3G25570 Adenosylmethionine decarboxyla... Lus10000156 27.1 0.8134

Lus10006139 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.