Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15530 167 / 1e-49 PPDK pyruvate orthophosphate dikinase (.1.2.3.4.5.6)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012770 [exp] 209 / 5e-64 AT4G15530 1541 / 0.0 pyruvate orthophosphate dikinase (.1.2.3.4.5.6) Lus10034005 [exp] 207 / 2e-63 AT4G15530 1504 / 0.0 pyruvate orthophosphate dikinase (.1.2.3.4.5.6)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G027800 [exp] 174 / 9e-52 AT4G15530 1592 / 0.0 pyruvate orthophosphate dikinase (.1.2.3.4.5.6)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006147 pacid=23148578 polypeptide=Lus10006147 locus=Lus10006147.g ID=Lus10006147.BGIv1.0 annot-version=v1.0 ATGCCTGGAATGATGGACACTGTCCTTAATCTGGGACTCAACGATGAGGTTGCATCCAGTTTAAGTGCCAAGAGCGGAGAGCGGTTCGCTTACGACTCGT ACCGGGGCTTCCTAGACATATTTGGCGGTGGCGTGATGGGGATTCCGCACTCCTCCTTCAAAGAGAAATTGGAAGGGATGAAGGAAGCTAAAGGAGCGAG GCTCGACACCGATCTGTCAGCTTCCGATCTGAAAGAGCTGGTGGAGCAGTACAAGCAAGTGTATGTTGAATCGACCGGAGATAAGTTCCCTTCGGATCCC AAGCAGCAACTGCTCTTGGCGGTGTTCGGTTCGTAG
AA sequence Show only first row Show all	>Lus10006147 pacid=23148578 polypeptide=Lus10006147 locus=Lus10006147.g ID=Lus10006147.BGIv1.0 annot-version=v1.0 MPGMMDTVLNLGLNDEVASSLSAKSGERFAYDSYRGFLDIFGGGVMGIPHSSFKEKLEGMKEAKGARLDTDLSASDLKELVEQYKQVYVESTGDKFPSDP KQQLLLAVFGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15530		PPDK	pyruvate orthophosphate dikina...		Lus10006147 [exp]	0	1
AT1G21000			PLATZ transcription factor fam...		Lus10005350 [exp]	2.8	0.9974
					Lus10011766 [exp]	3.3	0.9468
AT5G52605			Defensin-like (DEFL) family pr...		Lus10031095 [exp]	4.0	0.9974
AT5G63180			Pectin lyase-like superfamily ...		Lus10022310 [exp]	4.4	0.8024
					Lus10035508 [exp]	4.9	0.9974
AT5G56670			Ribosomal protein S30 family p...		Lus10019054 [exp]	5.7	0.9974
AT3G18040		ATMPK9	MAP kinase 9 (.1.2)		Lus10038956 [exp]	6.3	0.9974
					Lus10012269 [exp]	6.9	0.9974
AT5G04347			Plant self-incompatibility pro...		Lus10029375 [exp]	7.5	0.9974
AT5G48540			receptor-like protein kinase-r...		Lus10030777 [exp]	8.0	0.9974

Compare expression of checked genes

Lus10006147 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.