Lus10006160 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G33590 142 / 3e-41 Leucine-rich repeat (LRR) family protein (.1)
AT1G33600 131 / 2e-37 Leucine-rich repeat (LRR) family protein (.1)
AT2G26380 124 / 8e-35 Leucine-rich repeat (LRR) family protein (.1)
AT1G33610 122 / 6e-34 Leucine-rich repeat (LRR) family protein (.1)
AT1G33670 117 / 4e-32 Leucine-rich repeat (LRR) family protein (.1)
AT1G33612 115 / 3e-31 Leucine-rich repeat (LRR) family protein (.1)
AT5G23400 57 / 2e-10 Leucine-rich repeat (LRR) family protein (.1)
AT5G12940 55 / 9e-10 Leucine-rich repeat (LRR) family protein (.1)
AT3G12610 54 / 2e-09 DRT100 DNA-DAMAGE REPAIR/TOLERATION 100, Leucine-rich repeat (LRR) family protein (.1)
AT3G12145 52 / 6e-09 FLOR1, FLR1 FLOR1, Leucine-rich repeat (LRR) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041064 189 / 5e-60 AT1G33590 488 / 3e-171 Leucine-rich repeat (LRR) family protein (.1)
Lus10002936 166 / 3e-50 AT1G33590 594 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Lus10002937 150 / 2e-44 AT1G33590 559 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Lus10004827 57 / 3e-10 AT3G47570 812 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10031824 56 / 5e-10 AT3G20820 527 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Lus10037955 56 / 6e-10 AT3G47570 462 / 6e-151 Leucine-rich repeat protein kinase family protein (.1)
Lus10002551 55 / 1e-09 AT3G20820 476 / 1e-168 Leucine-rich repeat (LRR) family protein (.1)
Lus10013454 54 / 2e-09 AT5G23400 536 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Lus10030847 54 / 2e-09 AT3G47570 746 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G098900 127 / 1e-35 AT1G33590 582 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.013G098850 123 / 2e-34 AT1G33590 629 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.007G016700 74 / 3e-16 AT5G46330 286 / 5e-84 FLAGELLIN-SENSITIVE 2, Leucine-rich receptor-like protein kinase family protein (.1)
Potri.005G117700 62 / 3e-12 AT3G24240 240 / 1e-67 Leucine-rich repeat receptor-like protein kinase family protein (.1)
Potri.005G030800 53 / 5e-09 AT3G47570 576 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.005G031700 52 / 1e-08 AT5G20480 368 / 3e-113 EF-TU receptor (.1)
Potri.007G009200 51 / 2e-08 AT5G65700 1530 / 0.0 BARELY ANY MERISTEM 1, Leucine-rich receptor-like protein kinase family protein (.1.2)
Potri.010G040200 51 / 2e-08 AT5G23400 275 / 3e-83 Leucine-rich repeat (LRR) family protein (.1)
Potri.005G031300 51 / 2e-08 AT3G47570 574 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.009G064300 50 / 3e-08 AT3G12610 480 / 8e-171 DNA-DAMAGE REPAIR/TOLERATION 100, Leucine-rich repeat (LRR) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence
>Lus10006160 pacid=23148574 polypeptide=Lus10006160 locus=Lus10006160.g ID=Lus10006160.BGIv1.0 annot-version=v1.0
ATGAACTCCCTCTTTCTCTTCCTCTCCTTGCCAACTCTCCAATGCCTCCAAGCTACATCACGTGTCTGTCACGTGGATGACGAATCAGGTCACTTAGCAT
TCAAATCGGGGATCACCCACGACCTGTCGGGTATGCTCTCCTCGTGGAAACCTGGTACCGATTGTTGCACTTGGGTAGGGATAACTTGTCTTTACAACGA
CCGAGTCACCGCCCTCTCGTTCTATGGCCAACTTGACAACTTCCTCTCCAGTACCATCTCACCGTCCCTCGCTAAGCTCAGGAACCTCGACGGTATATAC
CTCAGAAATATGAGAAACATTTCAGGTAACTTCCCAGTCTTTTTGTACGGAATGTCCAAATTTTAA
AA sequence
>Lus10006160 pacid=23148574 polypeptide=Lus10006160 locus=Lus10006160.g ID=Lus10006160.BGIv1.0 annot-version=v1.0
MNSLFLFLSLPTLQCLQATSRVCHVDDESGHLAFKSGITHDLSGMLSSWKPGTDCCTWVGITCLYNDRVTALSFYGQLDNFLSSTISPSLAKLRNLDGIY
LRNMRNISGNFPVFLYGMSKF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G33590 Leucine-rich repeat (LRR) fami... Lus10006160 0 1
Lus10017698 2.0 0.8893
AT5G44960 F-box/RNI-like/FBD-like domain... Lus10015246 2.8 0.8791
AT5G52260 MYB ATMYB19 myb domain protein 19 (.1) Lus10027456 3.5 0.8659
AT5G66870 AS2 LBD36, ASL1 LATERAL ORGAN BOUNDARIES DOMAI... Lus10019633 4.8 0.7412
AT3G05550 Hypoxia-responsive family prot... Lus10015191 8.6 0.6873
AT4G21390 B120 S-locus lectin protein kinase ... Lus10032836 8.7 0.8494
Lus10022511 9.7 0.8494
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10013916 9.8 0.8491
AT2G36690 2-oxoglutarate (2OG) and Fe(II... Lus10024231 10.7 0.8494
Lus10010827 11.5 0.8494

Lus10006160 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.