Lus10006172 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G33760 79 / 6e-19 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G71450 69 / 3e-15 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G35700 50 / 3e-08 AP2_ERF ATERF38 ERF family protein 38 (.1)
AT5G11590 48 / 3e-07 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-binding superfamily protein (.1)
AT4G16750 47 / 7e-07 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT3G16280 45 / 2e-06 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G25810 44 / 5e-06 AP2_ERF TNY, TINY TINY, Integrase-type DNA-binding superfamily protein (.1)
AT4G32800 43 / 2e-05 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G44940 43 / 2e-05 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G25820 41 / 9e-05 AP2_ERF ESE2 ethylene and salt inducible 2, Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041052 190 / 3e-62 AT1G33760 143 / 3e-43 Integrase-type DNA-binding superfamily protein (.1)
Lus10002953 111 / 1e-31 AT1G33760 143 / 2e-43 Integrase-type DNA-binding superfamily protein (.1)
Lus10003513 104 / 6e-29 AT1G33760 140 / 2e-42 Integrase-type DNA-binding superfamily protein (.1)
Lus10041050 72 / 3e-16 AT1G71450 189 / 1e-61 Integrase-type DNA-binding superfamily protein (.1)
Lus10006173 60 / 7e-12 AT1G71450 167 / 4e-53 Integrase-type DNA-binding superfamily protein (.1)
Lus10034949 51 / 3e-08 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1)
Lus10027722 47 / 8e-07 AT4G25470 136 / 6e-40 FREEZING TOLERANCE QTL 4, DRE/CRT-BINDING PROTEIN 1C, C-repeat/DRE binding factor 2 (.1)
Lus10043240 46 / 2e-06 AT5G11590 176 / 1e-54 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10004738 45 / 2e-06 AT2G35700 144 / 7e-44 ERF family protein 38 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G075600 104 / 8e-29 AT1G33760 147 / 6e-45 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G054100 101 / 7e-28 AT1G71450 144 / 8e-44 Integrase-type DNA-binding superfamily protein (.1)
Potri.013G101200 101 / 1e-27 AT1G33760 149 / 1e-45 Integrase-type DNA-binding superfamily protein (.1)
Potri.013G101100 92 / 3e-24 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1)
Potri.019G075500 80 / 2e-19 AT1G71450 200 / 5e-66 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G181500 79 / 3e-19 AT1G71450 184 / 8e-60 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G079300 50 / 5e-08 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G155700 49 / 1e-07 AT2G44940 159 / 1e-47 Integrase-type DNA-binding superfamily protein (.1)
Potri.019G067400 48 / 3e-07 AT5G25810 120 / 6e-34 TINY, Integrase-type DNA-binding superfamily protein (.1)
Potri.002G141200 43 / 2e-05 AT2G44940 158 / 6e-47 Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10006172 pacid=23148546 polypeptide=Lus10006172 locus=Lus10006172.g ID=Lus10006172.BGIv1.0 annot-version=v1.0
ATGGCTCGGCAGCTACGCCACTCCCGAAATGGCAGCGGCAGCCTAGATAGGGGCGGGCCAGCGGACGACACGGCCGCATTGTACCTCCGTGGGCTTGAGG
GTGGGGCCCAACTCAACTTCCCGGAGCTGGCCCACTCCCTGCCCCGACCGGCCAGCTCGAGCGTCGAGGACGTCCAGACGGCGGCGCAACAAGCTGCGGC
GTTGATGATAATAACCCGGAAGCCGGATCCCTCGCCGGGAGTGGAGACGGCTGGTCGTTTTGGGCTGAGGCCGGTGCGGATCGGGTTATCACCCAGCCAA
ATCCAGGCGATTAACGAGACGCCGATGGATTCACCCAATATGTGGATGGAGTTAGCAGGAGGAGCTGTGTTTTTGGGAAGCTACTACGACACAGTTCCAA
TGAATTTGGATGGGCTGGTTATATGA
AA sequence
>Lus10006172 pacid=23148546 polypeptide=Lus10006172 locus=Lus10006172.g ID=Lus10006172.BGIv1.0 annot-version=v1.0
MARQLRHSRNGSGSLDRGGPADDTAALYLRGLEGGAQLNFPELAHSLPRPASSSVEDVQTAAQQAAALMIITRKPDPSPGVETAGRFGLRPVRIGLSPSQ
IQAINETPMDSPNMWMELAGGAVFLGSYYDTVPMNLDGLVI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G33760 AP2_ERF Integrase-type DNA-binding sup... Lus10006172 0 1
AT1G33760 AP2_ERF Integrase-type DNA-binding sup... Lus10041052 2.4 0.8729
AT2G36690 2-oxoglutarate (2OG) and Fe(II... Lus10001711 4.0 0.7977
AT5G44310 Late embryogenesis abundant pr... Lus10028304 5.7 0.7898
AT3G09450 unknown protein Lus10025334 6.2 0.8199
AT4G01140 Protein of unknown function (D... Lus10007859 7.1 0.7963
AT5G25840 Protein of unknown function (D... Lus10006044 9.6 0.8181
AT5G47830 unknown protein Lus10018732 13.7 0.7823
Lus10016420 15.1 0.7950
AT5G24530 DMR6 DOWNY MILDEW RESISTANT 6, 2-ox... Lus10032930 18.3 0.7731
Lus10002646 18.8 0.7045

Lus10006172 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.