Lus10006175 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71460 299 / 1e-96 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G46790 105 / 4e-25 CRR2 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G21090 100 / 2e-23 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G50390 100 / 3e-23 EMB3141 EMBRYO DEFECTIVE 3141, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT2G13600 100 / 3e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G59720 99 / 7e-23 CRR28 CHLORORESPIRATORY REDUCTION28, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G13770 97 / 3e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G18750 96 / 4e-22 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G37170 95 / 2e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G55740 94 / 4e-21 CRR21 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041049 601 / 0 AT1G71460 796 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10001230 116 / 6e-29 AT1G19720 890 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10033713 102 / 4e-24 AT1G03540 726 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10031714 100 / 2e-23 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040504 100 / 2e-23 AT3G13770 904 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10008618 99 / 5e-23 AT4G33990 367 / 4e-117 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030581 99 / 6e-23 AT1G68930 910 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10039117 99 / 9e-23 AT3G24000 740 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10032922 97 / 2e-22 AT3G26540 509 / 1e-173 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G075400 334 / 2e-110 AT1G71460 886 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.015G128800 112 / 7e-28 AT4G25270 664 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.011G052300 104 / 6e-25 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G030200 104 / 6e-25 AT1G19720 985 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.015G095100 103 / 9e-25 AT5G50390 865 / 0.0 EMBRYO DEFECTIVE 3141, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.009G037600 103 / 1e-24 AT3G46790 997 / 0.0 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G136200 102 / 2e-24 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.004G047800 101 / 8e-24 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G104700 100 / 1e-23 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G066100 100 / 3e-23 AT5G13270 977 / 0.0 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10006175 pacid=23148536 polypeptide=Lus10006175 locus=Lus10006175.g ID=Lus10006175.BGIv1.0 annot-version=v1.0
ATGGAAGCAACACAATTCCTACACGTATCTCCCCATCTCCACTTTCTGCTTCCAAATCCTATCCACTGCAACTCCGCCAAGCACCAAATCGACAAGTTCA
GATGTTCCGTTGCAACTCCGGAACTCGTCTCTCGCAACTTCGACAACAAGTACCCACGGAAACTCTTCTTCCGAAACCGCTCAAAGCAGCAGCGGCGGAA
GCCATTCAAGGAGAAAGATGCATTCCCGGAATCCCTCCCGCTCCACAACAGAAACCCACGAGCCATTTACAAAGACATCCAGAGACTGGTCCGGACCGAC
AAGCTGCCTCAAGCCCTAGCGGTAATGGACTATGTCGAGCAGCAGGGGATCCCTGTCAATGTCACCACTCTATCAGCCCTCATTGCCGGTTGCATTCGGA
CGAAGTCGTTGGCTGACGCCAGGCAGGTTCACTCCCATATTAGGATCCACGAGTTAGAAGGCAACGAGTTCTTGAAGAACAAATTGGTCCATATGTACAC
TGCTTGCAGGTCGATTGATGATGAACGCAAGGTGTTCGACGAATGTCTTTCGAGCAATGTCTATTCGTGGAATGCTTTGATTAGAGGGACTGTGATATCG
GGTAAGAAGAGGTATGGAGATGTAGTGTCTGCTTATGGGGAGATGAGGGAAATGGGTATTGAGCCAAATGAGTATACTTTCTGTAATGTCATCAAGAGCT
TTGCCGGTGCATCGGTTTTTAAGCAAGGGTTGAAGACTCATGCGATGCTGGTGAAGAGCGGGTGGATCGGTAGCTCGATTCTTAAAACCGGTTTGATTGA
CTTGTATTTTAAATGCGGGAATATCCGGTTTGCTCACCAAATGTTCGACGAAATGCCTGAAGCAAAAGACAGTACTCTGTAG
AA sequence
>Lus10006175 pacid=23148536 polypeptide=Lus10006175 locus=Lus10006175.g ID=Lus10006175.BGIv1.0 annot-version=v1.0
MEATQFLHVSPHLHFLLPNPIHCNSAKHQIDKFRCSVATPELVSRNFDNKYPRKLFFRNRSKQQRRKPFKEKDAFPESLPLHNRNPRAIYKDIQRLVRTD
KLPQALAVMDYVEQQGIPVNVTTLSALIAGCIRTKSLADARQVHSHIRIHELEGNEFLKNKLVHMYTACRSIDDERKVFDECLSSNVYSWNALIRGTVIS
GKKRYGDVVSAYGEMREMGIEPNEYTFCNVIKSFAGASVFKQGLKTHAMLVKSGWIGSSILKTGLIDLYFKCGNIRFAHQMFDEMPEAKDSTL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G71460 Pentatricopeptide repeat (PPR-... Lus10006175 0 1
AT4G35130 Tetratricopeptide repeat (TPR)... Lus10003233 1.4 0.8800
AT1G49600 ATRBP47A RNA-binding protein 47A (.1) Lus10012071 8.8 0.8336
AT5G22640 EMB1211 embryo defective 1211, MORN (M... Lus10009392 9.4 0.8851
AT4G18750 DOT4 DEFECTIVELY ORGANIZED TRIBUTAR... Lus10015225 9.8 0.8444
AT5G24650 Mitochondrial import inner mem... Lus10032959 11.6 0.8169
AT3G57430 OTP84 ORGANELLE TRANSCRIPT PROCESSIN... Lus10038400 16.9 0.8691
AT2G18940 Tetratricopeptide repeat (TPR)... Lus10006962 17.0 0.8523
AT5G22640 EMB1211 embryo defective 1211, MORN (M... Lus10020545 20.6 0.8753
AT1G79120 Ubiquitin carboxyl-terminal hy... Lus10032172 21.9 0.8116
AT1G12770 ISE1, EMB1586 INCREASED SIZE EXCLUSION LIMIT... Lus10038140 29.1 0.8408

Lus10006175 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.