Lus10006189 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32590 121 / 2e-35 2Fe-2S ferredoxin-like superfamily protein (.1.2.3.4)
AT3G16250 70 / 3e-15 PnsB3, NDF4 Photosynthetic NDH subcomplex B 3, NDH-dependent cyclic electron flow 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041038 260 / 3e-90 AT4G32590 177 / 4e-57 2Fe-2S ferredoxin-like superfamily protein (.1.2.3.4)
Lus10038292 60 / 3e-11 AT3G16250 227 / 9e-76 Photosynthetic NDH subcomplex B 3, NDH-dependent cyclic electron flow 1 (.1)
Lus10025809 59 / 3e-11 AT3G16250 227 / 1e-75 Photosynthetic NDH subcomplex B 3, NDH-dependent cyclic electron flow 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G247300 135 / 7e-41 AT4G32590 190 / 2e-62 2Fe-2S ferredoxin-like superfamily protein (.1.2.3.4)
Potri.001G186800 55 / 1e-09 AT3G16250 203 / 8e-67 Photosynthetic NDH subcomplex B 3, NDH-dependent cyclic electron flow 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0486 Fer2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence
>Lus10006189 pacid=23148533 polypeptide=Lus10006189 locus=Lus10006189.g ID=Lus10006189.BGIv1.0 annot-version=v1.0
ATGTCAGCCATTCATTTCCCCGGCAGCACCCCAATCTCTCATCTGCCCTCCGATTGCTTTTCCCGGCAACGCAACCCCTACCGGAACCAAGCTGTGAAGT
ATTCTTTCCAAAGCAAAAGGAAGTTGTCGTCAGTCTCAGTAACCGCCGACCCATCGCAGATTGTTCCTGCTGAGAAGCCCGTAATTGCGCTCCACTTCAT
CGGGCCAAAGACAGCAAGTGATGGGAAGTACCCGGTGGAGGAAGCAAGAGCTATAAGTGGAGACAAACTTCTCAGGAACATTATGCTGGATAATAAAATC
GAGCTTTACGCTACCTATGGAAAAGTAATGAACTGTGGAGGTGGTGGAACGTGTGGAACCTGCATTGTTGAGATTGCTGAGGGAAATTATCTGCTGAATG
AAAGGACCAATGCTGAATTCCGGTATCTTAAGAAGGTTGTGGTTCAGAGGCTCCCTCAGTGGAAGAAATGA
AA sequence
>Lus10006189 pacid=23148533 polypeptide=Lus10006189 locus=Lus10006189.g ID=Lus10006189.BGIv1.0 annot-version=v1.0
MSAIHFPGSTPISHLPSDCFSRQRNPYRNQAVKYSFQSKRKLSSVSVTADPSQIVPAEKPVIALHFIGPKTASDGKYPVEEARAISGDKLLRNIMLDNKI
ELYATYGKVMNCGGGGTCGTCIVEIAEGNYLLNERTNAEFRYLKKVVVQRLPQWKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G32590 2Fe-2S ferredoxin-like superfa... Lus10006189 0 1
AT4G32590 2Fe-2S ferredoxin-like superfa... Lus10041038 1.0 0.9531
AT5G19855 AtRbcX2 homologue of cyanobacterial Rb... Lus10002563 6.7 0.9129
AT3G25805 unknown protein Lus10022435 7.2 0.9207
AT5G23120 HCF136 HIGH CHLOROPHYLL FLUORESCENCE ... Lus10017401 8.7 0.9070
AT2G46735 unknown protein Lus10030208 9.2 0.8908
AT1G53670 MSRB1, ATMSRB1 methionine sulfoxide reductase... Lus10013727 11.2 0.9054
AT5G24930 CO COL4, ATCOL4 CONSTANS-like 4 (.1) Lus10026238 11.5 0.9039
AT3G09600 MYB LCL5 (LHY-CCA1-... REVEILLE 8, LHY-CCA1-LIKE5, Ho... Lus10014015 14.9 0.8653
AT3G25805 unknown protein Lus10016741 15.3 0.8945
AT5G19855 AtRbcX2 homologue of cyanobacterial Rb... Lus10027363 15.9 0.8870

Lus10006189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.