Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02900 37 / 0.0006 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000923 [exp] 42 / 6e-06 AT2G32885 50 / 4e-09 Rapid alkalinization factor (RALF) family protein (.1) Lus10002259 [exp] 40 / 5e-05 AT2G34825 49 / 1e-08 RALF-like 20 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G131800 [exp] 38 / 0.0002 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.005G025800 [exp] 37 / 0.0005 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.013G017400 [exp] 36 / 0.0008 AT4G15800 123 / 1e-37 ralf-like 33 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [flax] [poplar] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Lus10006213 pacid=23139730 polypeptide=Lus10006213 locus=Lus10006213.g ID=Lus10006213.BGIv1.0 annot-version=v1.0 ATGTCCAAGTTGAAAATCGTCACCACTTCTTCTTCTTCCATTTCTGTAGTAATTTTATTGTTGTTGTGCCTATTGATTGCAAGAGAAACCCAGGCTAAGA CGATCAGTTACGAGACTCTTGCAGAAGCTAACCCATTATGTGAAGGCGTTCGGAAGGAAGATTGCAAACAACCAGTATCGGCTAATTCATATCAAAGAGG CTGTAGCAATATAAACCGATGTCGCAGCGGAGGAAATCTCGACGGAGCAATGAAACCCGAATACCCAGACGGAGATTCTAGTGTCGAGGAGAAGGAAGGC GGAGGATTGTAA
AA sequence Show only first row Show all	>Lus10006213 pacid=23139730 polypeptide=Lus10006213 locus=Lus10006213.g ID=Lus10006213.BGIv1.0 annot-version=v1.0 MSKLKIVTTSSSSISVVILLLLCLLIARETQAKTISYETLAEANPLCEGVRKEDCKQPVSANSYQRGCSNINRCRSGGNLDGAMKPEYPDGDSSVEEKEG GGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G35467		RALFL5	RALF-like 5 (.1)		Lus10006213 [exp]	0	1
AT1G79460		ATKS1, ATKS, GA...	GA REQUIRING 2, ARABIDOPSIS TH...		Lus10006924 [exp]	1.4	0.7325
AT1G26930			Galactose oxidase/kelch repeat...		Lus10023608 [exp]	6.7	0.6805
AT5G14380		AGP6	arabinogalactan protein 6 (.1)		Lus10022309 [exp]	6.9	0.6768
					Lus10000085 [exp]	10.7	0.6515
					Lus10008145 [exp]	10.8	0.5043
					Lus10040421 [exp]	13.7	0.7131
AT1G24590	AP2_ERF	ESR2, DRNL, SOB...	FOR SUPPRESSOR OF PHYTOCHROMEB...		Lus10035076 [exp]	15.0	0.6029
AT1G18010			Major facilitator superfamily ...		Lus10009413 [exp]	17.3	0.6144
					Lus10013881 [exp]	19.2	0.6083
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013920 [exp]	21.9	0.6052

Compare expression of checked genes

Lus10006213 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.