Lus10006214 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26510 123 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
AT1G70640 110 / 7e-31 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1)
AT3G48240 102 / 1e-27 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G49920 92 / 8e-23 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G57610 92 / 5e-22 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT5G63130 86 / 2e-21 Octicosapeptide/Phox/Bem1p family protein (.1)
AT1G79570 89 / 7e-21 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT2G35050 89 / 1e-20 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT1G04700 86 / 2e-19 PB1 domain-containing protein tyrosine kinase (.1)
AT1G16270 85 / 2e-19 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036862 313 / 8e-111 AT3G26510 122 / 3e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10026700 131 / 8e-39 AT3G26510 135 / 3e-40 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10043341 108 / 8e-30 AT3G48240 145 / 2e-44 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10019490 107 / 2e-29 AT3G48240 149 / 9e-46 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10035641 90 / 2e-22 AT5G09620 243 / 6e-78 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10040006 93 / 5e-22 AT3G46920 604 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Lus10002588 92 / 5e-22 AT4G05150 319 / 2e-104 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10006977 92 / 6e-22 AT5G57610 1048 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Lus10031173 92 / 7e-22 AT1G79570 963 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G046400 139 / 2e-41 AT3G26510 152 / 5e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.008G186500 138 / 4e-41 AT3G26510 152 / 1e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.012G085000 103 / 4e-28 AT5G63130 139 / 4e-42 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.015G083400 100 / 5e-27 AT3G48240 152 / 2e-47 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.004G032200 91 / 1e-21 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.006G170700 89 / 9e-21 AT5G57610 1087 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Potri.011G041100 88 / 1e-20 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.009G080200 88 / 2e-20 AT5G64430 281 / 6e-89 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.001G123500 87 / 4e-20 AT2G35050 660 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Potri.006G190200 87 / 4e-20 AT3G46920 652 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00564 PB1 PB1 domain
Representative CDS sequence
>Lus10006214 pacid=23139688 polypeptide=Lus10006214 locus=Lus10006214.g ID=Lus10006214.BGIv1.0 annot-version=v1.0
ATGGCAACTACTACTTCGCCGGACTCAGCCACCATCAAGTTCCAATGCAGCCACGGCGGCAAGCTCGTCCCCCGCCCCCTCGACGGCAAGCTCCGCTACC
ACGGTGGCGAAACCCGAGTCCTCAGGGTCAGCCGATCGATTTCCTACTCCGAATTATTGATCAAGTTAGGGCGGCTAAATTATGAGGACACTAAGGTGGT
GCGTTTGCGTTGCCAATTGCCTGAGGTGGATCTTGATGACGCACTGGTGAACATAGTCTCCGACGAGGATTTGACTAGTCTCATCGAGGAATACGATCGA
GTTGCTACTCCTGCAACCTCGTCCTTAAAGATCAGGGCCTTCCTCTCGTCTCCGACAAAAGTATCTGCCGATGATCTATCCTCTACTTCATCTTCCTCAT
CCTCGTCCTCGTCCTCCTCGTCACATACTTTTGATGCAAGGTTATGTTCCTCCAAATGTTTCAATAGATGGGCTTCAAAGACGACAACGGTGGCTTCTCC
GGCGAGGAAGATCCCCCGATATGGTTACGTCTACGACAGAAATTAA
AA sequence
>Lus10006214 pacid=23139688 polypeptide=Lus10006214 locus=Lus10006214.g ID=Lus10006214.BGIv1.0 annot-version=v1.0
MATTTSPDSATIKFQCSHGGKLVPRPLDGKLRYHGGETRVLRVSRSISYSELLIKLGRLNYEDTKVVRLRCQLPEVDLDDALVNIVSDEDLTSLIEEYDR
VATPATSSLKIRAFLSSPTKVSADDLSSTSSSSSSSSSSSSHTFDARLCSSKCFNRWASKTTTVASPARKIPRYGYVYDRN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26510 Octicosapeptide/Phox/Bem1p fam... Lus10006214 0 1
AT2G16630 Pollen Ole e 1 allergen and ex... Lus10026279 1.0 0.9791
AT3G26510 Octicosapeptide/Phox/Bem1p fam... Lus10036862 3.3 0.9240
AT2G23110 Late embryogenesis abundant pr... Lus10042745 7.7 0.9090
AT3G19550 unknown protein Lus10002114 8.3 0.9380
AT2G23110 Late embryogenesis abundant pr... Lus10029709 8.4 0.9252
AT3G19550 unknown protein Lus10013901 9.4 0.9355
AT4G19510 Disease resistance protein (TI... Lus10008318 11.1 0.8470
AT1G29010 unknown protein Lus10013977 13.0 0.9400
AT3G48360 ATBT2, BT2 BTB and TAZ domain protein 2 (... Lus10018087 17.9 0.8728
AT4G32110 Beta-1,3-N-Acetylglucosaminylt... Lus10042384 19.4 0.9095

Lus10006214 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.