Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036864 [exp] 133 / 9e-43 ND / Lus10006665 [exp] 77 / 2e-18 AT1G49320 177 / 3e-53 unknown seed protein like 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G185900 [exp] 53 / 8e-11 ND / Potri.010G047000 [exp] 37 / 0.0001 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006216 pacid=23139707 polypeptide=Lus10006216 locus=Lus10006216.g ID=Lus10006216.BGIv1.0 annot-version=v1.0 ATGTCGTCATCATCATCCAGAATGAATAACCATTATGCAGGATACGGCTATGATCCTTCAAAATGTGACGAGGTTAAGCGGTTCGAGAGATCTCCTCCTT CACCTATATGTGTCAAGTTTGGCAATCAAAAAATTTGCAGCGACAATGTCGACACGGTAGCTGAAGAGTTCATCAGATTGGAGCACAGAAAGTTCGAAGC TAGCAAGACCATGTCCATCAACTATGGATAA
AA sequence Show only first row Show all	>Lus10006216 pacid=23139707 polypeptide=Lus10006216 locus=Lus10006216.g ID=Lus10006216.BGIv1.0 annot-version=v1.0 MSSSSSRMNNHYAGYGYDPSKCDEVKRFERSPPSPICVKFGNQKICSDNVDTVAEEFIRLEHRKFEASKTMSINYG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006216 [exp]	0	1
AT5G38200			Class I glutamine amidotransfe...		Lus10035996 [exp]	1.7	0.8863
AT5G39150			RmlC-like cupins superfamily p...		Lus10003114 [exp]	2.0	0.8935
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Lus10021992 [exp]	3.2	0.8778
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10004781 [exp]	4.2	0.8897
AT1G49570			Peroxidase superfamily protein...		Lus10023858 [exp]	5.7	0.8450
AT1G62300	WRKY	ATWRKY6, WRKY6	WRKY family transcription fact...		Lus10021554 [exp]	11.7	0.8250
AT5G57280		RID2	root initiation defective 2, S...		Lus10015533 [exp]	12.2	0.8375
AT4G13830		J20	DNAJ-like 20 (.1.2)		Lus10002356 [exp]	14.3	0.8822
AT1G60420			DC1 domain-containing protein ...		Lus10029148 [exp]	15.3	0.8207
AT1G66400		CML23	calmodulin like 23 (.1)		Lus10021732 [exp]	16.2	0.8056

Compare expression of checked genes

Lus10006216 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.