Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22470 102 / 3e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62930 98 / 1e-24 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62914 97 / 2e-24 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G63150 96 / 3e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G17140 96 / 4e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63130 95 / 9e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G64100 95 / 1e-23 pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2) AT3G16710 95 / 1e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G06000 94 / 2e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) AT1G62680 94 / 2e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022861 [exp] 177 / 9e-54 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10039310 [exp] 167 / 4e-53 AT3G22470 226 / 6e-70 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014242 [exp] 170 / 2e-52 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014245 [exp] 172 / 6e-52 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10024962 [exp] 167 / 2e-50 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014244 [exp] 168 / 3e-50 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014247 [exp] 167 / 4e-50 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009201 [exp] 161 / 5e-50 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003433 [exp] 166 / 1e-49 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G257300 [exp] 119 / 2e-32 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074700 [exp] 117 / 7e-32 AT1G62930 481 / 1e-164 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G271400 [exp] 116 / 2e-31 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G047400 [exp] 115 / 3e-31 AT1G63080 341 / 1e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G032100 [exp] 115 / 5e-31 AT1G62930 451 / 2e-152 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G045000 [exp] 115 / 6e-31 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.014G117600 [exp] 114 / 9e-31 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G038400 [exp] 114 / 1e-30 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046200 [exp] 114 / 2e-30 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G271200 [exp] 112 / 5e-30 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10006217 pacid=23139720 polypeptide=Lus10006217 locus=Lus10006217.g ID=Lus10006217.BGIv1.0 annot-version=v1.0 ATGATCAACGGATATTGTAAGAACAAAAGATTTGGCGAAGCCAAACAGTTATTGGATGATATGCTTGAAAAGGATTTACCTCCCAGCACTATTACGTACA ATACTCTGGTGGATGGGTTTTGCCGGGCAGGGAGGCTTAACGATGCGCAAGAAATATTCAAGAAAATGTGCAATCGAGCACAGTCCCCGGACGTCGAGAC TTGCTGCAGTTTGCTTAGTGGCTGGTGTGGAATAGGGAAAATCGATACCGCATTAGCTATGTTTGAAGAAATGGTGAGTACTAGCAGGTTGAAGCGTAAT ATTGTCATCTGTAACATTCTTATCAATGCTTTGTGGAAAGCAGGGAGGGTGAAGGAATCAAGAGACGTATTCTAG
AA sequence Show only first row Show all	>Lus10006217 pacid=23139720 polypeptide=Lus10006217 locus=Lus10006217.g ID=Lus10006217.BGIv1.0 annot-version=v1.0 MINGYCKNKRFGEAKQLLDDMLEKDLPPSTITYNTLVDGFCRAGRLNDAQEIFKKMCNRAQSPDVETCCSLLSGWCGIGKIDTALAMFEEMVSTSRLKRN IVICNILINALWKAGRVKESRDVF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22470			Pentatricopeptide repeat (PPR)...		Lus10006217 [exp]	0	1
AT4G27680			P-loop containing nucleoside t...		Lus10008835 [exp]	13.0	0.7537
AT1G78010			tRNA modification GTPase, puta...		Lus10029578 [exp]	18.2	0.7492
AT1G18750	MADS	AGL65, AGL102	AGAMOUS-like 65 (.1.2)		Lus10019089 [exp]	21.8	0.7348
AT5G41980			unknown protein		Lus10024452 [exp]	32.3	0.7123
AT1G78910			Pseudouridine synthase family ...		Lus10033350 [exp]	37.2	0.7230
AT1G22830			Tetratricopeptide repeat (TPR)...		Lus10003509 [exp]	38.5	0.6371
AT3G05350			Metallopeptidase M24 family pr...		Lus10029923 [exp]	41.9	0.7257
AT2G25870			haloacid dehalogenase-like hyd...		Lus10038133 [exp]	47.9	0.7196
AT5G06600		AtUBP12, UBP12	ubiquitin-specific protease 12...		Lus10013548 [exp]	62.2	0.6927
AT3G47390		PHS1	PHOTOSENSITIVE 1, cytidine/deo...		Lus10020208 [exp]	75.8	0.6945

Compare expression of checked genes

Lus10006217 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.