Lus10006225 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06273 eIF-4B Plant specific eukaryotic initiation factor 4B
Representative CDS sequence
>Lus10006225 pacid=23139717 polypeptide=Lus10006225 locus=Lus10006225.g ID=Lus10006225.BGIv1.0 annot-version=v1.0
ATGTCGAAACCCTGGGGCAACATCGGAACCTGGGCCGCCGAGGCCGAGCGCGAGGAAGAAGAAATGGAAGCTGCAGCCGCCTCCGCCGCCAAAGCTCCCC
CTCCCCCGCCAAAGCTCCTCCTCCCGACACAAAGAGCTACCCTAGCTTGA
AA sequence
>Lus10006225 pacid=23139717 polypeptide=Lus10006225 locus=Lus10006225.g ID=Lus10006225.BGIv1.0 annot-version=v1.0
MSKPWGNIGTWAAEAEREEEEMEAAAASAAKAPPPPPKLLLPTQRATLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10006225 0 1
AT1G64760 O-Glycosyl hydrolases family 1... Lus10031098 8.2 0.8793
AT2G18510 EMB2444 embryo defective 2444, RNA-bin... Lus10024024 11.3 0.8765
AT4G11420 ATTIF3A1, ATEIF... eukaryotic translation initiat... Lus10031477 12.8 0.8731
AT2G38550 Transmembrane proteins 14C (.1... Lus10025221 23.2 0.8477
AT4G38130 ATHDA19, ATHD1,... ARABIDOPSIS HISTONE DEACETYLAS... Lus10001356 24.0 0.8446
AT1G26460 Tetratricopeptide repeat (TPR)... Lus10004649 25.0 0.8547
AT4G35730 Regulator of Vps4 activity in ... Lus10041836 25.0 0.8608
AT5G66330 Leucine-rich repeat (LRR) fami... Lus10041809 31.7 0.8103
AT3G04610 FLK flowering locus KH domain, RNA... Lus10000120 36.8 0.8389
AT5G56680 SYNC1ARATH, SYN... EMBRYO DEFECTIVE 2755, Class I... Lus10012920 37.5 0.8260

Lus10006225 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.