Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24530 110 / 5e-30 Transducin/WD40 repeat-like superfamily protein (.1) AT1G24130 92 / 2e-23 Transducin/WD40 repeat-like superfamily protein (.1) AT3G50390 83 / 6e-20 Transducin/WD40 repeat-like superfamily protein (.1) AT5G50120 81 / 2e-19 Transducin/WD40 repeat-like superfamily protein (.1) AT4G34380 81 / 3e-19 Transducin/WD40 repeat-like superfamily protein (.1) AT3G18950 81 / 5e-19 Transducin/WD40 repeat-like superfamily protein (.1) AT1G49450 79 / 2e-18 Transducin/WD40 repeat-like superfamily protein (.1) AT2G26490 71 / 1e-15 Transducin/WD40 repeat-like superfamily protein (.1) AT1G47610 62 / 2e-12 Transducin/WD40 repeat-like superfamily protein (.1) AT3G51930 58 / 3e-11 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036881 [exp] 161 / 2e-49 AT1G24530 409 / 5e-141 Transducin/WD40 repeat-like superfamily protein (.1) Lus10006460 [exp] 115 / 4e-32 AT1G24530 414 / 3e-143 Transducin/WD40 repeat-like superfamily protein (.1) Lus10011402 [exp] 115 / 6e-32 AT1G24530 406 / 3e-140 Transducin/WD40 repeat-like superfamily protein (.1) Lus10043466 [exp] 92 / 6e-23 AT5G50120 399 / 3e-136 Transducin/WD40 repeat-like superfamily protein (.1) Lus10034117 [exp] 87 / 2e-21 AT5G50120 391 / 1e-134 Transducin/WD40 repeat-like superfamily protein (.1) Lus10029206 [exp] 83 / 5e-20 AT1G24130 353 / 5e-119 Transducin/WD40 repeat-like superfamily protein (.1) Lus10023836 [exp] 77 / 1e-17 AT3G18950 431 / 3e-147 Transducin/WD40 repeat-like superfamily protein (.1) Lus10009510 [exp] 76 / 1e-17 AT3G50390 245 / 1e-75 Transducin/WD40 repeat-like superfamily protein (.1) Lus10016289 [exp] 76 / 2e-17 AT2G26490 597 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G050900 [exp] 113 / 5e-31 AT1G24530 483 / 5e-170 Transducin/WD40 repeat-like superfamily protein (.1) Potri.012G076000 [exp] 97 / 2e-25 AT5G50120 417 / 5e-145 Transducin/WD40 repeat-like superfamily protein (.1) Potri.015G070900 [exp] 94 / 3e-24 AT5G50120 398 / 2e-137 Transducin/WD40 repeat-like superfamily protein (.1) Potri.005G131100 [exp] 82 / 9e-20 AT3G50390 535 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.007G035100 [exp] 82 / 2e-19 AT3G50390 514 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.006G239600 [exp] 82 / 2e-19 AT3G50390 280 / 4e-89 Transducin/WD40 repeat-like superfamily protein (.1) Potri.009G109500 [exp] 80 / 5e-19 AT3G18950 555 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.004G148400 [exp] 79 / 1e-18 AT3G18950 539 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.014G038400 [exp] 79 / 2e-18 AT2G26490 631 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.002G130400 [exp] 78 / 4e-18 AT2G26490 632 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10006233 pacid=23139722 polypeptide=Lus10006233 locus=Lus10006233.g ID=Lus10006233.BGIv1.0 annot-version=v1.0 ATGGCGGTCACCGGAGCTTTGAGGGGCCACAGAGGAGCGGTGCTGTGTTTGATCAACGTCGGGGATTTGCTGATGAGCGGGTCCGGTGATCGGACTGTGA GGATTTGGCGGAGGGGGAGCAGCGACGGGAAGTATGGCTGCTTGGCGGTTTTGGAAGGTCATGAGAAGGCCGTGAAGTCGTTGGTTGCCGAAAAGGGCGA AGACAGCGACGTTTTGGTTTATAGTGGGAGTTTGGAGGGGGAGATTAAGGTATGGAGAGTCCAGATCGAGAAAATTGTATTGAAAGAACGAATATAA
AA sequence Show only first row Show all	>Lus10006233 pacid=23139722 polypeptide=Lus10006233 locus=Lus10006233.g ID=Lus10006233.BGIv1.0 annot-version=v1.0 MAVTGALRGHRGAVLCLINVGDLLMSGSGDRTVRIWRRGSSDGKYGCLAVLEGHEKAVKSLVAEKGEDSDVLVYSGSLEGEIKVWRVQIEKIVLKERI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G24530			Transducin/WD40 repeat-like su...		Lus10006233 [exp]	0	1
					Lus10012740 [exp]	1.0	0.8850
AT3G02645			Plant protein of unknown funct...		Lus10009504 [exp]	1.4	0.8750
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Lus10039680 [exp]	3.0	0.8246
AT1G70140		ATFH8	formin 8 (.1)		Lus10029212 [exp]	4.8	0.7452
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Lus10007525 [exp]	6.5	0.7816
AT2G24580			FAD-dependent oxidoreductase f...		Lus10020132 [exp]	14.3	0.8029
AT5G56040			Leucine-rich receptor-like pro...		Lus10042090 [exp]	26.1	0.7555
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Lus10028333 [exp]	36.7	0.7874
AT5G65490			unknown protein		Lus10002654 [exp]	44.5	0.7623
AT4G27950	AP2_ERF	CRF4	cytokinin response factor 4 (....		Lus10027573 [exp]	50.6	0.7378

Compare expression of checked genes

Lus10006233 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.