Lus10006239 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10006239 pacid=23139701 polypeptide=Lus10006239 locus=Lus10006239.g ID=Lus10006239.BGIv1.0 annot-version=v1.0
ATGGCACTCAACAAGGTCGTTATCCTCGCTCTCTTCTTCGCCGCCGTGATCAGCGTCGCCACCGCTGCTGAGCCGGCAGCCGACGCCGCCGCTGGCGAGA
AGAATGCCACCGCGAATGCAACCGACGCCGCTGCTTCCCCAGATGCCATCGGAACTACTGATGGGGACGCGTCCGCACCCACCGCTAACGGAGATGTAGC
TCCCGGACCCGTAGGAAGTGGCGCCGGGGCCGGAGCTCCTGCCGCCGAGGCTCCCAAGAGCGATGCCAACACTGTCTCTGTCTCCGCCGCCGCTGGCATT
GCCGCCGTTGCTGGATACTTTGTTATGTAA
AA sequence
>Lus10006239 pacid=23139701 polypeptide=Lus10006239 locus=Lus10006239.g ID=Lus10006239.BGIv1.0 annot-version=v1.0
MALNKVVILALFFAAVISVATAAEPAADAAAGEKNATANATDAAASPDAIGTTDGDASAPTANGDVAPGPVGSGAGAGAPAAEAPKSDANTVSVSAAAGI
AAVAGYFVM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10006239 0 1
AT5G27510 Protein kinase superfamily pro... Lus10034285 5.7 0.6599
AT1G02335 GL22 germin-like protein subfamily ... Lus10004857 37.5 0.5921
AT3G55950 CCR3, ATCRR3 CRINKLY4 related 3 (.1) Lus10034646 54.1 0.5250
AT5G20690 Leucine-rich repeat protein ki... Lus10005175 54.3 0.5330
AT3G53170 Tetratricopeptide repeat (TPR)... Lus10024144 59.4 0.5208
AT1G19880 Regulator of chromosome conden... Lus10010614 80.4 0.4916
AT2G29060 GRAS GRAS family transcription fact... Lus10037752 88.2 0.5180
AT1G52190 Major facilitator superfamily ... Lus10008539 95.5 0.5234
AT2G01770 ATVIT1, VIT1 vacuolar iron transporter 1 (.... Lus10003704 200.8 0.4872
AT1G60630 Leucine-rich repeat protein ki... Lus10019429 205.8 0.4870

Lus10006239 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.