Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14610 129 / 9e-36 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT1G67110 127 / 3e-35 CYP735A2 "cytochrome P450, family 735, subfamily A, polypeptide 2", cytochrome P450, family 735, subfamily A, polypeptide 2 (.1) AT3G14630 125 / 2e-34 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) AT1G17060 119 / 2e-32 SHK1, CHI2, SOB7, CYP72C1 SUPPRESSOR OF PHYB-4 7, SHRINK 1, CHIBI 2, cytochrome p450 72c1 (.1) AT1G75130 118 / 7e-32 CYP721A1 "cytochrome P450, family 721, subfamily A, polypeptide 1", cytochrome P450, family 721, subfamily A, polypeptide 1 (.1) AT3G14690 117 / 1e-31 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT5G38450 117 / 2e-31 CYP735A1 "cytochrome P450, family 735, subfamily A, polypeptide 1", cytochrome P450, family 735, subfamily A, polypeptide 1 (.1) AT3G14680 117 / 2e-31 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT3G14620 117 / 2e-31 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT3G14640 117 / 2e-31 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036942 [exp] 264 / 8e-84 AT2G26710 375 / 2e-119 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10006245 [exp] 243 / 3e-76 AT2G26710 345 / 4e-108 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036823 [exp] 211 / 3e-70 AT3G14610 227 / 2e-71 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) Lus10036820 [exp] 211 / 7e-67 AT2G26710 397 / 2e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10019186 [exp] 141 / 6e-43 AT2G46950 134 / 1e-36 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1) Lus10036822 [exp] 144 / 7e-41 AT2G26710 410 / 4e-137 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10026681 [exp] 142 / 3e-40 AT3G14620 322 / 4e-103 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Lus10004633 [exp] 137 / 9e-39 AT2G26710 378 / 4e-126 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10019184 [exp] 134 / 1e-37 AT3G14680 369 / 2e-122 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G139400 [exp] 162 / 2e-48 AT2G26710 402 / 2e-135 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139300 [exp] 152 / 1e-44 AT2G26710 372 / 1e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.019G071200 [exp] 150 / 1e-43 AT2G26710 346 / 9e-114 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139500 [exp] 145 / 4e-42 AT3G14620 283 / 4e-90 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Potri.019G014407 [exp] 144 / 1e-41 AT2G26710 389 / 3e-130 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.010G139600 [exp] 142 / 6e-41 AT2G26710 395 / 6e-133 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.011G099200 [exp] 130 / 2e-37 AT3G14660 466 / 3e-163 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) Potri.010G139200 [exp] 129 / 7e-36 AT2G26710 369 / 6e-123 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.011G098800 [exp] 127 / 3e-35 AT3G14690 640 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G101500 [exp] 126 / 7e-35 AT3G14690 609 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10006246 pacid=23139684 polypeptide=Lus10006246 locus=Lus10006246.g ID=Lus10006246.BGIv1.0 annot-version=v1.0 ATGATCATCGACGAATCTTTGAGGCTATACCCACCGTTCTTCCACGTTTCATGGAGAGTCGAGAGAGATCAAGTACGACTCGGGCCAGGGAAGCTAATAC TTCCGAAAGGGACCGAAGTTTACATTCCGTTTCTAGCGGTTCACCACAAGACCGAAACATGGGGGGAAGACGCTGAGCTTTTCAGACCGGAGAGGTTTGC AGAAGGGGCAGTAGCTAAGGCATCCGCAACGTTTACGCCGTTCGGGTTGGGGCCGTGGACTTGTGTTGGTATGAACTTTGCAATGATGCAGATGAAGATT GCAGTTGCCATGATCCTGCAGCTTTCCAGGCTTAGGCTATCGGACAAGTATGTACATTCTCCAGCTCAGGTTTTGACTAGCTGTCCACGCTATGGCCTGC AAATCGTTCTTGAGAAATTGATCAAATGA
AA sequence Show only first row Show all	>Lus10006246 pacid=23139684 polypeptide=Lus10006246 locus=Lus10006246.g ID=Lus10006246.BGIv1.0 annot-version=v1.0 MIIDESLRLYPPFFHVSWRVERDQVRLGPGKLILPKGTEVYIPFLAVHHKTETWGEDAELFRPERFAEGAVAKASATFTPFGLGPWTCVGMNFAMMQMKI AVAMILQLSRLRLSDKYVHSPAQVLTSCPRYGLQIVLEKLIK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67110		CYP735A2	"cytochrome P450, family 735, ...		Lus10006246 [exp]	0	1
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10006245 [exp]	1.0	0.9195
AT4G35160			O-methyltransferase family pro...		Lus10023987 [exp]	4.5	0.9155
AT5G19875			unknown protein		Lus10008006 [exp]	4.9	0.8640
AT1G71890		SUC5, ATSUC5	SUCROSE-PROTON SYMPORTER 5, Ma...		Lus10028886 [exp]	6.9	0.8947
AT5G28010			Polyketide cyclase/dehydrase a...		Lus10008930 [exp]	7.7	0.8947
					Lus10042813 [exp]	9.5	0.9012
AT5G42510			Disease resistance-responsive ...		Lus10038298 [exp]	12.0	0.8407
AT5G16970		AT-AER	alkenal reductase (.1)		Lus10035274 [exp]	16.4	0.8778
AT4G14060			Polyketide cyclase/dehydrase a...		Lus10008932 [exp]	17.0	0.8810
AT1G79700	AP2_ERF		Integrase-type DNA-binding sup...		Lus10005513 [exp]	17.9	0.8776

Compare expression of checked genes

Lus10006246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.