Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50210 364 / 3e-126 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G49630 325 / 5e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G49620 320 / 1e-108 DIN11 DARK INDUCIBLE 11, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19010 99 / 2e-23 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G21420 91 / 1e-20 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G55970 90 / 4e-20 ATJRG21 jasmonate-regulated gene 21 (.1) AT5G05600 90 / 5e-20 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G35190 89 / 6e-20 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT2G38240 88 / 2e-19 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G11180 87 / 5e-19 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041597 [exp] 315 / 9e-109 AT3G50210 177 / 1e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10021002 [exp] 96 / 4e-22 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004808 [exp] 95 / 6e-22 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005037 [exp] 94 / 2e-21 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011476 [exp] 94 / 2e-21 AT1G15550 412 / 1e-143 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Lus10012963 [exp] 89 / 6e-20 AT1G35190 498 / 7e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004387 [exp] 89 / 1e-19 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10034964 [exp] 89 / 1e-19 AT1G35190 493 / 9e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011979 [exp] 89 / 1e-19 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G047100 [exp] 404 / 7e-142 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Potri.001G355100 [exp] 104 / 2e-25 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1) Potri.010G200900 [exp] 100 / 9e-24 AT3G21420 288 / 4e-95 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101200 [exp] 99 / 2e-23 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G057400 [exp] 98 / 6e-23 AT1G15550 451 / 2e-159 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.018G086800 [exp] 97 / 7e-23 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 97 / 1e-22 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.016G117100 [exp] 97 / 1e-22 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G355200 [exp] 96 / 2e-22 AT1G17020 329 / 3e-111 senescence-related gene 1 (.1) Potri.004G146000 [exp] 95 / 6e-22 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10006259 pacid=23149669 polypeptide=Lus10006259 locus=Lus10006259.g ID=Lus10006259.BGIv1.0 annot-version=v1.0 ATGATCTGTGTGCTGTTTTTCCACTGGTGGGATTGTGCAGATATGGGTCCTTTACTAGCAAAGAGCGATGACCCAGATATGGGTTTAGACCCTGCTGTGG CTCAAGTTGTTCAACAACTGGACCAGGCTTGTAGAAAAGCTGGCTTCTTCTATGTGAAAGGTCACGGTATACCAGATTCGTTAGTGAAAGAGGTGAAGAG TATAGCTCACAAGTTTTTCCATCTTCCTTACGAGGAGAAGTTAAAGATCAAAATGAGTCCTGGAGCTGGATATAGAGGATATCAGAGAGTTGGAGAGAAT GTAACCAAAGGCGTCCCTGACATGCATGAAGCTATTGATTGCTATACAGAAATAGAACCTGGGAGGTATGGAGCTCTTGGCAAGGCAATGGAAGGATGTA ACCAGTGTTGCAATCTACTGTTAACAGAACTGTCGAGAAAAATTATGCAAGGTATTGCTTTGGCATTGGGCGGATCGCCATCTGAATTTGAAGGTGATAT AGCTGGAGAGCCTTTCTGGGTGCTGCGCATCATTGGTTACCCTGGTCTTACAGCAGATGATCATTACAAATCTGAACATGATGTTGGATGGTTAAGGCTG AATCACTGTTTCCTTTGTGACCAAACAATTAAAGTGGAGCTCATACCGACTATGGACGATGGTATAACTGCACTTCAGGTGAGGAATCTATCTGGCGCGT GGATATCTGCTCCACCGATACCTGGTACATTCGTATGCAACATAGGGGACATGTTGAAGATATGGAGTAATGGTATCTATGATTCAACTGTTCATCGAGT TGTCAATAACAACACCAAATATCGCGTCTGTGTTGCTTATTTCTACGAGACGAATTTCGATGCGACAGTTGAACCCGTAGATTTTTGCATCAAGAAGAGT GGTGGAGTAAGGAGGTTGGGAAGAGCTGTGTATGGAGAACATTTGGTTTCCAAAGTTCAAACAAACTTCGTCTGA
AA sequence Show only first row Show all	>Lus10006259 pacid=23149669 polypeptide=Lus10006259 locus=Lus10006259.g ID=Lus10006259.BGIv1.0 annot-version=v1.0 MICVLFFHWWDCADMGPLLAKSDDPDMGLDPAVAQVVQQLDQACRKAGFFYVKGHGIPDSLVKEVKSIAHKFFHLPYEEKLKIKMSPGAGYRGYQRVGEN VTKGVPDMHEAIDCYTEIEPGRYGALGKAMEGCNQCCNLLLTELSRKIMQGIALALGGSPSEFEGDIAGEPFWVLRIIGYPGLTADDHYKSEHDVGWLRL NHCFLCDQTIKVELIPTMDDGITALQVRNLSGAWISAPPIPGTFVCNIGDMLKIWSNGIYDSTVHRVVNNNTKYRVCVAYFYETNFDATVEPVDFCIKKS GGVRRLGRAVYGEHLVSKVQTNFV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G50210			2-oxoglutarate (2OG) and Fe(II...		Lus10006259 [exp]	0	1
AT4G33150		LKR/SDH, SDH	lysine-ketoglutarate reductase...		Lus10038086 [exp]	1.7	0.9709
AT3G28050			nodulin MtN21 /EamA-like trans...		Lus10010695 [exp]	2.2	0.9623
AT4G34890		ATXDH1	xanthine dehydrogenase 1 (.1)		Lus10034306 [exp]	2.4	0.9694
AT1G74100		SOT16, ATSOT16,...	CORONATINE INDUCED-7, ARABIDOP...		Lus10031621 [exp]	3.5	0.9584
AT3G55960			Haloacid dehalogenase-like hyd...		Lus10002484 [exp]	4.0	0.9615
AT1G44170		ALDH4, ALDH3H1	aldehyde dehydrogenase 4, alde...		Lus10029684 [exp]	4.2	0.9622
AT2G44420			protein N-terminal asparagine ...		Lus10033495 [exp]	4.7	0.9601
AT5G65790	MYB	AtMYB68	myb domain protein 68 (.1)		Lus10028248 [exp]	6.0	0.9650
AT5G10860		CBSX3	CBS domain containing protein ...		Lus10021675 [exp]	6.1	0.9435
AT3G04970			DHHC-type zinc finger family p...		Lus10018967 [exp]	6.9	0.9572

Compare expression of checked genes

Lus10006259 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.