Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G21105 115 / 5e-36 cytochrome-c oxidases;electron carriers (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006276 [exp] 139 / 4e-45 AT4G21105 113 / 5e-35 cytochrome-c oxidases;electron carriers (.1.2) Lus10020569 [exp] 139 / 1e-44 AT4G21105 114 / 3e-34 cytochrome-c oxidases;electron carriers (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G460200 [exp] 118 / 3e-37 AT4G21105 116 / 2e-36 cytochrome-c oxidases;electron carriers (.1.2) Potri.011G156400 [exp] 118 / 5e-37 AT4G21105 117 / 2e-36 cytochrome-c oxidases;electron carriers (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02238 [flax] [poplar] COX7a Cytochrome c oxidase subunit VII
Representative CDS sequence Show only first row Show all	>Lus10006275 pacid=23181451 polypeptide=Lus10006275 locus=Lus10006275.g ID=Lus10006275.BGIv1.0 annot-version=v1.0 ATGGTTGAAGCAGAAACACCATTCAGACCAAGGGAGAAGCTCCTCGAGAAGCAAAGGTACTTCCAGAACATGCACAAGTACACTCACTTGAAAGGACCTA TGGATAAGGTCACCTCGGTCGCCATCCCTCTAGCCTTGGCTGCAACCTCATTGTACCTCATCGGACGAGGTATCTACAACATGTCCCATGGGATCGGGAA GAAAGAGTGA
AA sequence Show only first row Show all	>Lus10006275 pacid=23181451 polypeptide=Lus10006275 locus=Lus10006275.g ID=Lus10006275.BGIv1.0 annot-version=v1.0 MVEAETPFRPREKLLEKQRYFQNMHKYTHLKGPMDKVTSVAIPLALAATSLYLIGRGIYNMSHGIGKKE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G21105			cytochrome-c oxidases;electron...		Lus10006275 [exp]	0	1
AT1G04850			ubiquitin-associated (UBA)/TS-...		Lus10037827 [exp]	3.9	0.9385
AT2G45430	AT-hook	AHL22	AT-hook motif nuclear-localize...		Lus10007007 [exp]	3.9	0.9518
AT5G56710			Ribosomal protein L31e family ...		Lus10015698 [exp]	4.2	0.9494
AT3G11510			Ribosomal protein S11 family p...		Lus10022693 [exp]	6.2	0.9489
AT4G26210			Mitochondrial ATP synthase sub...		Lus10001771 [exp]	6.9	0.9389
AT5G09300			Thiamin diphosphate-binding fo...		Lus10020895 [exp]	8.5	0.9336
AT3G61140		EMB78, CSN1, CO...	EMBRYO DEFECTIVE 78, COP9 SIGN...		Lus10036566 [exp]	8.5	0.9438
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Lus10001681 [exp]	8.7	0.9472
AT2G33040		ATP3	gamma subunit of Mt ATP syntha...		Lus10042366 [exp]	9.5	0.9326
AT3G26340			N-terminal nucleophile aminohy...		Lus10011369 [exp]	9.5	0.9401

Compare expression of checked genes

Lus10006275 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.