Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G21105 113 / 3e-35 cytochrome-c oxidases;electron carriers (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020569 [exp] 145 / 5e-47 AT4G21105 114 / 3e-34 cytochrome-c oxidases;electron carriers (.1.2) Lus10006275 [exp] 139 / 4e-45 AT4G21105 115 / 7e-36 cytochrome-c oxidases;electron carriers (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G460200 [exp] 120 / 6e-38 AT4G21105 116 / 2e-36 cytochrome-c oxidases;electron carriers (.1.2) Potri.011G156400 [exp] 114 / 2e-35 AT4G21105 117 / 2e-36 cytochrome-c oxidases;electron carriers (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02238 [flax] [poplar] COX7a Cytochrome c oxidase subunit VII
Representative CDS sequence Show only first row Show all	>Lus10006276 pacid=23181462 polypeptide=Lus10006276 locus=Lus10006276.g ID=Lus10006276.BGIv1.0 annot-version=v1.0 ATGGTTGAAGCGGAAACGCCTTTCAGACCGAGGGAGAAGCTCATCGAGAAGCAGAGGTACTACCAGAACGTGCACAAGTACACCCACTTGAAAGGACCTA TGGACAAGGTCACCTCTGTTGCTATCCCCATTGCTTTGGCTGCTACTTCGCTGTTTCTCATCGGTCGTGGCATCTACAACATGTCTCACGGGATCGGGAA GAAAGAATGA
AA sequence Show only first row Show all	>Lus10006276 pacid=23181462 polypeptide=Lus10006276 locus=Lus10006276.g ID=Lus10006276.BGIv1.0 annot-version=v1.0 MVEAETPFRPREKLIEKQRYYQNVHKYTHLKGPMDKVTSVAIPIALAATSLFLIGRGIYNMSHGIGKKE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G21105			cytochrome-c oxidases;electron...		Lus10006276 [exp]	0	1
AT3G10860			Cytochrome b-c1 complex, subun...		Lus10019118 [exp]	4.5	0.8238
AT2G42210		ATOEP16-3	Mitochondrial import inner mem...		Lus10016278 [exp]	6.2	0.8619
AT1G01170			Protein of unknown function (D...		Lus10042373 [exp]	7.7	0.7851
AT3G15140			Polynucleotidyl transferase, r...		Lus10005381 [exp]	9.6	0.8064
AT3G59280		TXR1	THAXTOMIN A RESISTANT 1, Prote...		Lus10032532 [exp]	12.0	0.8036
AT3G55440		CYTOTPI, ATCTIM...	CYTOSOLIC ISOFORM TRIOSE PHOSP...		Lus10004963 [exp]	13.0	0.8043
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Lus10018052 [exp]	13.5	0.8090
AT1G76200			unknown protein		Lus10016001 [exp]	16.8	0.8043
AT1G67350			unknown protein		Lus10015785 [exp]	27.9	0.7607
AT3G48030			hypoxia-responsive family prot...		Lus10002358 [exp]	28.3	0.7769

Compare expression of checked genes

Lus10006276 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.