Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020524 [exp] 87 / 1e-21 AT1G27170 395 / 9e-119 transmembrane receptors;ATP binding (.1.2) Lus10020536 [exp] 71 / 5e-16 AT1G27170 392 / 8e-118 transmembrane receptors;ATP binding (.1.2) Lus10026961 [exp] 57 / 5e-11 AT5G36930 420 / 2e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020537 [exp] 55 / 4e-10 AT1G27170 404 / 6e-121 transmembrane receptors;ATP binding (.1.2) Lus10020533 [exp] 43 / 6e-06 AT1G27170 405 / 1e-122 transmembrane receptors;ATP binding (.1.2) Lus10042714 [exp] 41 / 3e-05 AT5G36930 411 / 3e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10010574 [exp] 40 / 6e-05 AT5G36930 397 / 4e-119 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005373 [exp] 39 / 9e-05 AT5G36930 404 / 8e-121 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006287 pacid=23181446 polypeptide=Lus10006287 locus=Lus10006287.g ID=Lus10006287.BGIv1.0 annot-version=v1.0 ATGGAGTCATTGGAAGAACTAAAGATGTCCGGTTGCGAGTCGATTGAGGAGTTGCGGAATCTATCTGGTCTGAAAAACTTGAGTGAGTTGCTTCTCAAGG GATGGATACAGTTGAAAGAGGTGAATGGACTCGAGGGGTTGGAGTTGAGAGTCTTTGAAGCAGATGAAAGGATAAAAGTCAAGTACGTACCAAAATCAGT TGCAAGCTACGGCAAGTATATATGGTTGTTCATCGGCTGCATGATAATACTCATGTAG
AA sequence Show only first row Show all	>Lus10006287 pacid=23181446 polypeptide=Lus10006287 locus=Lus10006287.g ID=Lus10006287.BGIv1.0 annot-version=v1.0 MESLEELKMSGCESIEELRNLSGLKNLSELLLKGWIQLKEVNGLEGLELRVFEADERIKVKYVPKSVASYGKYIWLFIGCMIILM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006287 [exp]	0	1
AT2G40220	AP2_ERF	ATABI4, GIN6, S...	SUCROSE UNCOUPLED 6, SUGAR-INS...		Lus10009834 [exp]	1.0	0.8788
AT1G14200			RING/U-box superfamily protein...		Lus10005237 [exp]	3.5	0.8577
AT5G60770		ATNRT2.4	ARABIDOPSIS THALIANA NITRATE T...		Lus10016119 [exp]	5.1	0.8466
AT1G14590			Nucleotide-diphospho-sugar tra...		Lus10041976 [exp]	8.1	0.8626
AT4G02160			unknown protein		Lus10010018 [exp]	8.2	0.8397
AT5G39020			Malectin/receptor-like protein...		Lus10008333 [exp]	9.5	0.8620
AT4G26680			Tetratricopeptide repeat (TPR)...		Lus10020371 [exp]	11.8	0.7611
AT1G63740			Disease resistance protein (TI...		Lus10010546 [exp]	13.2	0.8137
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10014062 [exp]	13.2	0.8513
					Lus10029261 [exp]	14.5	0.8513

Compare expression of checked genes

Lus10006287 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.