Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23250 72 / 1e-16 RKC1, CRK17, DUF26-21, EMB1290 RECEPTOR-LIKE KINASE THALIANACOL-0GENOMICLIBRARY\(CLONTECH\).THEPOSITIVEPHAGECLONES C-X8-C-X2-C CLASS 1, EMBRYO DEFECTIVE 1290, CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 17, kinases;protein kinases (.1) AT4G23290 70 / 6e-16 CRK21 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2) AT4G23260 69 / 1e-15 CRK18 cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.2) AT4G11490 69 / 1e-15 CRK33 cysteine-rich RLK (RECEPTOR-like protein kinase) 33 (.1) AT3G16030 69 / 1e-15 CES101 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) AT4G11530 68 / 2e-15 CRK34 cysteine-rich RLK (RECEPTOR-like protein kinase) 34 (.1) AT4G23230 68 / 3e-15 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1) AT4G23210 67 / 5e-15 HIG1, CRK13 cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.2), cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.3) AT4G23200 67 / 8e-15 CRK12 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) AT4G23180 66 / 1e-14 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019061 [exp] 87 / 1e-21 AT4G21380 338 / 5e-104 receptor kinase 3 (.1) Lus10036314 [exp] 75 / 1e-17 AT4G23180 315 / 6e-102 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10041639 [exp] 72 / 2e-16 AT4G11900 338 / 7e-104 S-locus lectin protein kinase family protein (.1) Lus10024081 [exp] 72 / 2e-16 AT1G61500 333 / 5e-102 S-locus lectin protein kinase family protein (.1) Lus10025784 [exp] 68 / 3e-15 AT3G16030 596 / 0.0 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Lus10007633 [exp] 67 / 6e-15 AT4G05200 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018379 [exp] 67 / 9e-15 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10007634 [exp] 67 / 1e-14 AT4G23160 417 / 1e-137 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) Lus10041680 [exp] 66 / 2e-14 AT1G15520 1646 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G111900 [exp] 91 / 4e-23 AT3G16030 367 / 2e-114 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.018G111600 [exp] 77 / 3e-18 AT4G23180 377 / 2e-120 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.018G111700 [exp] 74 / 2e-17 AT4G23200 363 / 1e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111800 [exp] 73 / 5e-17 AT4G23200 362 / 4e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.011G027800 [exp] 71 / 3e-16 AT4G23180 516 / 9e-176 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.011G027600 [exp] 70 / 5e-16 AT4G23280 461 / 3e-156 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1) Potri.011G029000 [exp] 70 / 7e-16 AT4G21410 537 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.011G027900 [exp] 69 / 1e-15 AT4G23180 542 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.011G029700 [exp] 69 / 1e-15 AT4G21410 578 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.011G028800 [exp] 69 / 1e-15 AT4G21410 573 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006292 pacid=23153423 polypeptide=Lus10006292 locus=Lus10006292.g ID=Lus10006292.BGIv1.0 annot-version=v1.0 ATGGCAAGCCGTCCAACAGGCCTTCTAGAGTTGAAGAACGGGGTTTCCCTCACTGCAAGGCTTCAACATGTGAATCTGGTTAGGGTTGTGGGTTTCTACA CCGAGAACGGAGAAAATTTGTTGGTTTATGAGTTCAGGCCGAGCAGAAGCCTAGACCTTTACCTCTTCGAGCCTGTGAGGAGGTTAGAGTTGGACTAG
AA sequence Show only first row Show all	>Lus10006292 pacid=23153423 polypeptide=Lus10006292 locus=Lus10006292.g ID=Lus10006292.BGIv1.0 annot-version=v1.0 MASRPTGLLELKNGVSLTARLQHVNLVRVVGFYTENGENLLVYEFRPSRSLDLYLFEPVRRLELD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G16030		CES101	CALLUS EXPRESSION OF RBCS 101,...		Lus10006292 [exp]	0	1

Compare expression of checked genes

Lus10006292 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.