Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46620 132 / 2e-37 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G18193 102 / 2e-26 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G18190 101 / 5e-26 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28580 97 / 1e-24 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G17760 95 / 3e-24 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT4G25835 96 / 8e-24 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G17730 95 / 8e-24 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28510 95 / 1e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G17750 94 / 2e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G40010 94 / 3e-23 ASD, AATP1 ATPase-in-Seed-Development, AAA-ATPase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005991 [exp] 157 / 8e-47 AT2G46620 598 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10030220 [exp] 155 / 5e-46 AT2G46620 603 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10022362 [exp] 136 / 6e-40 AT2G46620 362 / 8e-123 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10008834 [exp] 128 / 1e-35 AT2G46620 473 / 2e-163 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10042166 [exp] 100 / 1e-25 AT5G40010 526 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10015354 [exp] 100 / 2e-25 AT5G40010 598 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10041918 [exp] 100 / 3e-25 AT3G50930 383 / 2e-126 cytochrome BC1 synthesis (.1) Lus10004258 [exp] 99 / 4e-25 AT3G28580 507 / 1e-176 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10028463 [exp] 98 / 8e-25 AT3G50930 340 / 2e-111 cytochrome BC1 synthesis (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G102300 [exp] 138 / 1e-39 AT2G46620 598 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.015G007800 [exp] 137 / 4e-39 AT2G46620 503 / 1e-175 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.002G175600 [exp] 136 / 5e-39 AT2G46620 627 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G020800 [exp] 132 / 2e-37 AT2G46620 536 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.009G024400 [exp] 107 / 4e-28 AT4G25835 362 / 4e-120 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.001G231200 [exp] 105 / 3e-27 AT4G25835 359 / 1e-118 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.007G012400 [exp] 104 / 4e-27 AT3G50940 367 / 2e-123 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.005G119200 [exp] 100 / 2e-25 AT1G43910 530 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.007G019600 [exp] 99 / 5e-25 AT1G43910 536 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.008G177200 [exp] 99 / 5e-25 AT3G50940 401 / 4e-136 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006295 pacid=23153424 polypeptide=Lus10006295 locus=Lus10006295.g ID=Lus10006295.BGIv1.0 annot-version=v1.0 ATGGTGGTGGAGTTCCGTTCTGTTCACTCATCCGTCAACGTTCGATACGATTGCGATGGAAATCTGAAAAGCAAGCTGAAGTCAGATATGGAGTTATTCC TTAGAGCCAAACAGTACTACCACCGTCTTGGCCGTGTTTGGAAGCGGAGCTACTTGTTGTACAGACCGTCAGGCACTGGAAAAACCAACTTCGTCGCCTT CATGGCGAATTTCTTGAGATACGACGTCTATGAGATCGACCTCTCCGGAGTCAGGGACGATTCCGATCTAAAGGCGATCCTGCGTCAGGCGACGTGGAGG TCGGTAATCGTGAGAGAGGATCTCGATCGGTTTCCAGACGGAGAAATCAAAATATTCAAAACCATCCGTCATGTCCTTGGCTGGTCAACATCCGTGTAA
AA sequence Show only first row Show all	>Lus10006295 pacid=23153424 polypeptide=Lus10006295 locus=Lus10006295.g ID=Lus10006295.BGIv1.0 annot-version=v1.0 MVVEFRSVHSSVNVRYDCDGNLKSKLKSDMELFLRAKQYYHRLGRVWKRSYLLYRPSGTGKTNFVAFMANFLRYDVYEIDLSGVRDDSDLKAILRQATWR SVIVREDLDRFPDGEIKIFKTIRHVLGWSTSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46620			P-loop containing nucleoside t...		Lus10006295 [exp]	0	1
AT2G26150	HSF	ATHSFA2	heat shock transcription facto...		Lus10027627 [exp]	5.7	0.7835
AT4G04720		CPK21	calcium-dependent protein kina...		Lus10020046 [exp]	5.8	0.8104
AT3G22530			unknown protein		Lus10035239 [exp]	7.5	0.7522
AT3G47490			HNH endonuclease (.1.2.3)		Lus10034462 [exp]	9.9	0.7905
AT2G42920			Pentatricopeptide repeat (PPR-...		Lus10012235 [exp]	13.0	0.7880
AT4G01130			GDSL-like Lipase/Acylhydrolase...		Lus10012644 [exp]	13.2	0.7549
AT5G56760		SAT-52, AtSerat...	SERINE ACETYLTRANSFERASE 52, s...		Lus10008567 [exp]	14.3	0.7904
AT5G03680	Trihelix	PTL	PETAL LOSS, Duplicated homeodo...		Lus10027718 [exp]	16.1	0.7761
AT3G22530			unknown protein		Lus10000009 [exp]	18.5	0.7498
AT4G32285			ENTH/ANTH/VHS superfamily prot...		Lus10043260 [exp]	21.2	0.7675

Compare expression of checked genes

Lus10006295 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.