Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000341 [exp] 68 / 6e-17 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006297 pacid=23153421 polypeptide=Lus10006297 locus=Lus10006297.g ID=Lus10006297.BGIv1.0 annot-version=v1.0 ATGAAAAAAGAGTTGGGGATCAGTGGAGCTGGGCCAGAGAAGCAAAAGCTGGAGGCAGAAAAAAAGTACCCGCCGACAATGGATCCGCCGGCCGGGGCAG CGTCGGACGTAAAAAGGTTGCTTGAAAATTTGACTGTTTCGTTGTTGAAGCTAAACCGGCGATCTAAGTGTTTATGCAAACGGTTTTCTATTTGA
AA sequence Show only first row Show all	>Lus10006297 pacid=23153421 polypeptide=Lus10006297 locus=Lus10006297.g ID=Lus10006297.BGIv1.0 annot-version=v1.0 MKKELGISGAGPEKQKLEAEKKYPPTMDPPAGAASDVKRLLENLTVSLLKLNRRSKCLCKRFSI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006297 [exp]	0	1
AT3G26320		CYP71B36	"cytochrome P450, family 71, s...		Lus10034010 [exp]	4.7	0.6939
AT3G06790			plastid developmental protein ...		Lus10037488 [exp]	11.4	0.7376
AT1G30670	bHLH	bHLH052	basic helix-loop-helix (bHLH) ...		Lus10005451 [exp]	15.1	0.7401
AT3G49950	GRAS		GRAS family transcription fact...		Lus10039709 [exp]	15.1	0.7572
AT2G32350			Ubiquitin-like superfamily pro...		Lus10039679 [exp]	15.9	0.7461
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10007208 [exp]	18.2	0.7356
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Lus10011472 [exp]	21.7	0.7155
AT1G70790			Calcium-dependent lipid-bindin...		Lus10034591 [exp]	22.9	0.7288
AT3G18010	HD	WOX1	WUSCHEL related homeobox 1 (.1...		Lus10018011 [exp]	24.1	0.7441
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10041151 [exp]	43.3	0.6554

Compare expression of checked genes

Lus10006297 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.