Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46490 49 / 1e-08 unknown protein AT5G35110 48 / 3e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000088 [exp] 226 / 1e-78 AT2G46490 49 / 2e-08 unknown protein Lus10000078 [exp] 164 / 5e-54 AT5G35110 49 / 1e-08 unknown protein Lus10006299 [exp] 164 / 5e-54 AT5G35110 49 / 1e-08 unknown protein Lus10006300 [exp] 164 / 5e-54 AT5G35110 49 / 1e-08 unknown protein Lus10003182 [exp] 47 / 9e-08 AT2G46490 49 / 7e-09 unknown protein Lus10040009 [exp] 44 / 1e-06 AT2G46490 74 / 7e-18 unknown protein Lus10019579 [exp] 44 / 1e-06 AT2G46490 73 / 1e-17 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G189700 [exp] 74 / 1e-18 AT5G35110 50 / 5e-09 unknown protein Potri.018G113901 [exp] 69 / 6e-15 AT5G35110 58 / 1e-10 unknown protein Potri.006G189600 [exp] 57 / 8e-12 AT5G35110 71 / 9e-17 unknown protein Potri.018G113700 [exp] 52 / 6e-10 AT5G35110 78 / 1e-19 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006298 pacid=23153425 polypeptide=Lus10006298 locus=Lus10006298.g ID=Lus10006298.BGIv1.0 annot-version=v1.0 ATGGCTCATGCAATAGCAAACATGGTGGTTCAGTGTGTATTTGACGGAAGCATATCGTTCCAGGACAACGAAATTGAGAGGAGACCGTACCATCGTAATT GCGAGTGTGCACTTCACGAATCCAACGGTAAGTGCTCCAAAATTCGGTGCATACAGAGGAACATGTCGTTTCAAAAGAAGACAATAGGCTTTTCGTTGGC CATAACAGCCGCTTCCTCATCTTGCAACTCAATTATTCCATCCCGATTTATATCAACTCTGGAGATGACGAACAATTTTGTTACCCCAGCCAAAGATACA TCCCATGATTGGGAACTCAACGAATAA
AA sequence Show only first row Show all	>Lus10006298 pacid=23153425 polypeptide=Lus10006298 locus=Lus10006298.g ID=Lus10006298.BGIv1.0 annot-version=v1.0 MAHAIANMVVQCVFDGSISFQDNEIERRPYHRNCECALHESNGKCSKIRCIQRNMSFQKKTIGFSLAITAASSSCNSIIPSRFISTLEMTNNFVTPAKDT SHDWELNE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46490			unknown protein		Lus10006298 [exp]	0	1

Compare expression of checked genes

Lus10006298 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.