Lus10006302 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G11650 281 / 2e-96 ATOSM34 osmotin 34 (.1)
AT1G75050 170 / 2e-52 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75040 166 / 3e-51 PR-5, PR5 pathogenesis-related gene 5 (.1)
AT1G75030 164 / 3e-50 ATLP-3 thaumatin-like protein 3 (.1)
AT1G77700 162 / 3e-48 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75800 160 / 1e-47 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G19320 157 / 2e-47 Pathogenesis-related thaumatin superfamily protein (.1)
AT4G38660 155 / 1e-45 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G20030 152 / 5e-45 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT2G17860 149 / 2e-44 Pathogenesis-related thaumatin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007034 352 / 2e-124 AT4G11650 293 / 5e-101 osmotin 34 (.1)
Lus10006690 350 / 1e-123 AT4G11650 292 / 1e-100 osmotin 34 (.1)
Lus10017170 311 / 3e-108 AT4G11650 251 / 2e-84 osmotin 34 (.1)
Lus10024511 288 / 8e-99 AT4G11650 315 / 5e-109 osmotin 34 (.1)
Lus10023897 171 / 5e-53 AT1G75800 271 / 8e-91 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10025055 155 / 1e-46 AT4G38660 359 / 6e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10025629 157 / 4e-46 AT1G77700 377 / 4e-130 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10017265 155 / 7e-46 AT1G75800 390 / 2e-136 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10032914 152 / 2e-45 AT5G24620 353 / 1e-121 Pathogenesis-related thaumatin superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G107800 334 / 1e-117 AT4G11650 291 / 1e-100 osmotin 34 (.1)
Potri.001G107950 331 / 2e-116 AT4G11650 287 / 6e-99 osmotin 34 (.1)
Potri.001G107600 290 / 9e-100 AT4G11650 356 / 1e-125 osmotin 34 (.1)
Potri.001G102400 288 / 4e-99 AT4G11650 360 / 2e-127 osmotin 34 (.1)
Potri.018G096063 283 / 2e-97 AT4G11650 314 / 2e-109 osmotin 34 (.1)
Potri.002G087100 164 / 8e-50 AT1G77700 384 / 2e-134 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.005G173900 159 / 6e-48 AT1G77700 316 / 2e-107 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.012G004800 158 / 3e-47 AT5G24620 358 / 1e-122 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.004G173200 157 / 2e-46 AT4G38660 357 / 5e-123 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.001G221900 154 / 3e-46 AT1G75800 271 / 5e-91 Pathogenesis-related thaumatin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0293 CDC PF00314 Thaumatin Thaumatin family
Representative CDS sequence
>Lus10006302 pacid=23178377 polypeptide=Lus10006302 locus=Lus10006302.g ID=Lus10006302.BGIv1.0 annot-version=v1.0
ATGGCTTCCCTTTCCCTCAAAGCAACCATCTCTCTACTAGCCATCGCAATCCTCACCACGTCCTTAACCATCTCGACCAACGCGGCCCGCTTCGACATAA
CAAACAAGTGCCCGTACACGGTATGGGCAGCGTCCGTCCCCGTAGGGGGCGGCCGCCAGCTCAACTCCGGCCAGACATGGACCATCGACGCCCCTCCTGG
GACCGCACAAGCCAGGATATGGGCCAGGACCAACTGCAGGTTCGACGCCTCCGGGAGGGGCAAATGCCAGACTGGGGACTGCGGCGGGGTCTTGCAATGC
AAGGGCTATGGCACAGCCCCCAACACGTTGGCGGAGTACGCGCTGAAGCAGTTCAACAACCTGGATTTCATCGACGTCTCGGTGATTGATGGTTACAACG
TCCCGATGGAGTTCAGCTCCACCTCGGGGAGCTGCAAAAGGGTGATCCGGTGTGCGGCCGACATCTTGGGCCAGTGCCCCCAGCAGCTGAAGGTCCCGGG
AGGTTGTAACGGGCCGTGTCCCGTGTTTAAGACGGAGGAGCATTGTTGTAACTCGGGGCGCTGCGGTCCGACGAATTATTCGAGGTTTTTCAAGGATAGG
TGCCCTAATGCTTATAGTTACCCTAAGGATGATCCGACGAGCACTTTCACTTGCCCTTCTGGGACTAATTATAAGGTTGTTTTCTGTCCTTAG
AA sequence
>Lus10006302 pacid=23178377 polypeptide=Lus10006302 locus=Lus10006302.g ID=Lus10006302.BGIv1.0 annot-version=v1.0
MASLSLKATISLLAIAILTTSLTISTNAARFDITNKCPYTVWAASVPVGGGRQLNSGQTWTIDAPPGTAQARIWARTNCRFDASGRGKCQTGDCGGVLQC
KGYGTAPNTLAEYALKQFNNLDFIDVSVIDGYNVPMEFSSTSGSCKRVIRCAADILGQCPQQLKVPGGCNGPCPVFKTEEHCCNSGRCGPTNYSRFFKDR
CPNAYSYPKDDPTSTFTCPSGTNYKVVFCP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10006302 0 1
AT1G02360 Chitinase family protein (.1) Lus10009968 4.5 0.8185
AT3G22060 Receptor-like protein kinase-r... Lus10027145 5.3 0.8048
AT3G14130 Aldolase-type TIM barrel famil... Lus10008133 6.3 0.7375
Lus10039778 12.0 0.7904
AT5G25930 Protein kinase family protein ... Lus10034976 13.7 0.7297
AT2G15780 Cupredoxin superfamily protein... Lus10025269 14.5 0.7510
AT1G03790 C3HZnF SOM SOMNUS, Zinc finger C-x8-C-x5-... Lus10018621 18.1 0.7509
AT5G25190 AP2_ERF ESE3 ethylene and salt inducible 3,... Lus10005343 18.2 0.7497
AT4G08850 Leucine-rich repeat receptor-l... Lus10031161 26.8 0.6900
AT4G21700 Protein of unknown function (D... Lus10030937 27.1 0.7246

Lus10006302 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.