Lus10006317 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07730 251 / 1e-81 Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT2G28670 241 / 7e-80 ESB1 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT2G39430 187 / 1e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G55230 174 / 2e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G24020 150 / 2e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G13580 147 / 8e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G28671 84 / 1e-18 unknown protein
AT1G22900 61 / 3e-11 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 61 / 4e-11 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21100 61 / 7e-11 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029585 245 / 7e-83 AT2G28670 166 / 6e-53 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Lus10011767 150 / 5e-44 AT3G24020 339 / 7e-119 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10023689 150 / 6e-44 AT3G24020 336 / 1e-117 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10003301 130 / 5e-34 AT3G55230 254 / 2e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10030318 123 / 9e-34 AT3G55230 276 / 2e-93 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 67 / 4e-13 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 64 / 2e-12 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 65 / 7e-12 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 63 / 2e-11 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G049200 297 / 7e-101 AT2G28670 276 / 2e-90 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.010G211800 297 / 7e-101 AT2G28670 257 / 6e-83 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.010G211900 196 / 3e-60 AT2G39430 249 / 3e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.008G049100 189 / 1e-57 AT2G39430 251 / 6e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G054100 162 / 2e-48 AT4G13580 308 / 3e-106 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G174300 152 / 7e-45 AT3G24020 315 / 2e-109 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G054000 151 / 2e-44 AT3G24020 352 / 5e-124 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.010G212000 99 / 2e-24 AT1G07730 103 / 1e-25 Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G134800 64 / 3e-12 AT1G64160 188 / 4e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.008G061400 61 / 7e-11 AT2G21110 223 / 7e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10006317 pacid=23178373 polypeptide=Lus10006317 locus=Lus10006317.g ID=Lus10006317.BGIv1.0 annot-version=v1.0
ATGGAGACCCTCGGGATTCTTTTGCTCATCATGCTCACCGTTGCATTCACCACATCGGCTAGAAAGCTCGACGAACAGCCAGTGAAGCCCGAAACCCCAC
TGGCTGCTGCACCGGTTCCTCCCGCAGAAACCAACCCTATTGTTGGATTAGCGGAAGGTGGCCATGCCATGACATTCTTTATGCACGATATTCTTGGAGG
GTCGAACCCGTCCACAAGAGCAGTGACGGGAGTAGTGAACAACCCGGCAATCAACGGCCAGGTCCCATTCTCCAAACCCAACGGAGCCGTCCTCCCGGTC
AACAACGGAGTCAACCAAAACAACAACAACAACGGAGTGCTCAACAACAACAACTTGCCGTTCCTCACCGGCCTCGGCGGGACCACGGCCAATGTGATAC
AGAACAACAACAATGGAAACAACAACGGGTTCAATAATTTCCCGGCTTCCATCAACGGAGGCCAGCTCCCGACAGGCTCGGCCCTGGGGCAGCTAATGTT
CGGGACCATCACAGTGATCGACGATGAGCTCACAGAAGGGCATGAATTGGGGTCTCCTCTTGTGGGGAAAGCACAAGGGTACTACGTGGCGAGTTCGATT
GATGGAAACAGTCAGGCCATGGCGTTCACTGCCATGTTCCATAGTGGTCATTATGAAGATAGTCTAAACTTCTTCGGAGTTCATAGGGCCGGTGTGTCGG
AATCTCAGCTTGCTGTAATGGGCGGGACGGGGAAGTATGTGAATGCTAAGGGACATGCTGTTGTGAAGACCATTGTTCCCGGTGCAGCTGGAATTGGAAA
TCAGCATGAAACTGATGGGTTTGAGACTTTGCTGGAGTTTACTGTTTATGTTGCATACTGA
AA sequence
>Lus10006317 pacid=23178373 polypeptide=Lus10006317 locus=Lus10006317.g ID=Lus10006317.BGIv1.0 annot-version=v1.0
METLGILLLIMLTVAFTTSARKLDEQPVKPETPLAAAPVPPAETNPIVGLAEGGHAMTFFMHDILGGSNPSTRAVTGVVNNPAINGQVPFSKPNGAVLPV
NNGVNQNNNNNGVLNNNNLPFLTGLGGTTANVIQNNNNGNNNGFNNFPASINGGQLPTGSALGQLMFGTITVIDDELTEGHELGSPLVGKAQGYYVASSI
DGNSQAMAFTAMFHSGHYEDSLNFFGVHRAGVSESQLAVMGGTGKYVNAKGHAVVKTIVPGAAGIGNQHETDGFETLLEFTVYVAY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28670 ESB1 ENHANCED SUBERIN 1, Disease re... Lus10006317 0 1
AT2G28670 ESB1 ENHANCED SUBERIN 1, Disease re... Lus10029585 1.0 0.9848
AT3G55230 Disease resistance-responsive ... Lus10030318 2.0 0.9811
AT3G04830 Protein prenylyltransferase su... Lus10001785 4.5 0.9360
AT3G15730 PLDALPHA1 phospholipase D alpha 1 (.1) Lus10018575 5.2 0.9581
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Lus10041055 5.3 0.9451
AT3G51770 ATEOL1, ETO1 ARABIDOPSIS ETHYLENE OVERPRODU... Lus10031859 6.0 0.9382
Lus10024121 6.9 0.9413
AT1G15520 ATABCG40, ABCG4... Arabidopsis thaliana ATP-bindi... Lus10034020 7.3 0.9240
AT2G47270 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA... Lus10002419 7.7 0.9439
AT5G10720 CKI2, AHK5 CYTOKININ INDEPENDENT 2, histi... Lus10020114 8.9 0.9215

Lus10006317 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.