Plant FIBer expression Database

Lus10006327 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G16740 212 / 2e-72 Ribosomal protein L20 (.1)
ATCG00660 57 / 1e-11 ATCG00660.1, RPL20 ribosomal protein L20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029597
[exp]
259 / 5e-91 AT1G16740 213 / 7e-73 Ribosomal protein L20 (.1)
Lus10034785
[exp]
253 / 9e-88 AT1G16740 212 / 2e-71 Ribosomal protein L20 (.1)
Lus10033326
[exp]
243 / 1e-84 AT1G16740 206 / 3e-70 Ribosomal protein L20 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G119300
[exp]
228 / 8e-79 AT1G16740 235 / 1e-81 Ribosomal protein L20 (.1)
Potri.004G095475
[exp]
100 / 6e-29 AT1G16740 107 / 4e-32 Ribosomal protein L20 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00453 Ribosomal_L20 Ribosomal protein L20
Representative CDS sequence
>Lus10006327 pacid=23178354 polypeptide=Lus10006327 locus=Lus10006327.g ID=Lus10006327.BGIv1.0 annot-version=v1.0
ATGTTGAACAAGAAGGAGATTTTCAAGCTAGCAAAAGGGTTTAGGGGGAGGGCAAAGAACTGCATCAGGATAGCAAGAGAGAGGGTTGAGAAGGCGTTGC
AGTATTCCTACAGGGACCGTAGGAACAAGAAGCGTGACATGCGCTCGCTATGGATTCAACGAATCAGTGCTGGCACCAGGCAGCATAATGTTCATTATGG
ACACTTCATGCATGGGCTTAAGAAAGAGAACATCCAGCTGAACCGGAAAGTGTTGTCTGAGGTATCCATGCACGAGCCGTACAGTTTCAAGGCACTGGTA
GACATCTCTCGCACTGCCTTCCCAGGAAACAAACACATCTTCCATCGTCCCAGGAAGGTAGACACGCCAATCAATGTGTAG
AA sequence
>Lus10006327 pacid=23178354 polypeptide=Lus10006327 locus=Lus10006327.g ID=Lus10006327.BGIv1.0 annot-version=v1.0
MLNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRISAGTRQHNVHYGHFMHGLKKENIQLNRKVLSEVSMHEPYSFKALV
DISRTAFPGNKHIFHRPRKVDTPINV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G16740 Ribosomal protein L20 (.1) Lus10006327
[exp]
0 1
AT1G54310 S-adenosyl-L-methionine-depend... Lus10001763
[exp]
1.0 0.8008
AT5G55530 Calcium-dependent lipid-bindin... Lus10032578
[exp]
5.3 0.7635
AT2G09990 Ribosomal protein S5 domain 2-... Lus10038012
[exp]
5.5 0.7970
AT2G31410 unknown protein Lus10031995
[exp]
6.7 0.7938
AT5G46160 Ribosomal protein L14p/L23e fa... Lus10023296
[exp]
7.7 0.7912
AT1G16350 Aldolase-type TIM barrel famil... Lus10000276
[exp]
11.5 0.7501
AT5G14680 Adenine nucleotide alpha hydro... Lus10014545
[exp]
11.6 0.7927
AT4G17880 bHLH bHLH004, MYC4 Basic helix-loop-helix (bHLH) ... Lus10004575
[exp]
14.1 0.7886
AT5G02380 MT2B metallothionein 2B (.1) Lus10024396
[exp]
14.3 0.7142
AT5G27470 seryl-tRNA synthetase / serine... Lus10017409
[exp]
15.0 0.7883

Lus10006327 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.