Lus10006328 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52060 194 / 2e-60 ATBAG1 BCL-2-associated athanogene 1 (.1)
AT5G62100 186 / 5e-58 ATBAG2 BCL-2-associated athanogene 2 (.1.2.3)
AT5G07220 171 / 4e-52 ATBAG3 BCL-2-associated athanogene 3 (.1)
AT3G51780 134 / 7e-38 ATBAG4 BCL-2-associated athanogene 4 (.1)
AT5G14360 69 / 2e-14 Ubiquitin-like superfamily protein (.1)
AT5G40630 67 / 9e-14 Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029598 442 / 2e-159 AT5G52060 195 / 8e-61 BCL-2-associated athanogene 1 (.1)
Lus10038882 206 / 1e-65 AT5G52060 327 / 1e-111 BCL-2-associated athanogene 1 (.1)
Lus10015004 201 / 3e-63 AT5G52060 333 / 4e-114 BCL-2-associated athanogene 1 (.1)
Lus10027420 201 / 5e-63 AT5G52060 349 / 6e-120 BCL-2-associated athanogene 1 (.1)
Lus10005772 162 / 4e-48 AT5G52060 304 / 2e-102 BCL-2-associated athanogene 1 (.1)
Lus10023279 141 / 4e-41 AT5G07220 196 / 4e-62 BCL-2-associated athanogene 3 (.1)
Lus10005051 126 / 1e-33 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1)
Lus10027822 122 / 6e-33 AT3G51780 221 / 4e-71 BCL-2-associated athanogene 4 (.1)
Lus10003393 87 / 2e-20 AT3G51780 180 / 5e-56 BCL-2-associated athanogene 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G110300 249 / 5e-82 AT5G52060 239 / 2e-76 BCL-2-associated athanogene 1 (.1)
Potri.003G121500 246 / 2e-81 AT5G52060 243 / 1e-78 BCL-2-associated athanogene 1 (.1)
Potri.012G133400 218 / 8e-70 AT5G52060 305 / 2e-102 BCL-2-associated athanogene 1 (.1)
Potri.015G135500 213 / 1e-67 AT5G52060 303 / 2e-101 BCL-2-associated athanogene 1 (.1)
Potri.001G358200 143 / 1e-41 AT5G07220 207 / 9e-66 BCL-2-associated athanogene 3 (.1)
Potri.009G074300 142 / 4e-41 AT3G51780 196 / 4e-62 BCL-2-associated athanogene 4 (.1)
Potri.001G279500 141 / 6e-41 AT3G51780 210 / 2e-67 BCL-2-associated athanogene 4 (.1)
Potri.001G339100 81 / 1e-18 AT5G14360 166 / 6e-53 Ubiquitin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02179 BAG BAG domain
Representative CDS sequence
>Lus10006328 pacid=23178336 polypeptide=Lus10006328 locus=Lus10006328.g ID=Lus10006328.BGIv1.0 annot-version=v1.0
ATGGAGGAGGCAATCAAGTCAATGATGAAAGTTGAAGAATTGGAAATCAGGCCAGGAGGAATGTTGGTTCAGAAGAGGGATTCTTCTGAATCCAGAAATC
ATAGTTACAGCAACGACAATTCAATTGTTGTGCCTGTGATCAGAGTCAAGGTCAAATTTGGATCCTCATATCACAATGTTTCCATCACTTCTCAAGCTAG
CTTTGGGGAGCTGAAGAAAATGTTGGCAGAAGTAACAAAAGTTCACCATCAGGACCAGAAGTTGATGTACAAGAAGAAAGAGAAGGACTCCAGGATGTTT
TTGGACATTGAAAGAGTGAAAGATGGATCCAAACTCGTTCTTATTGAGGACATTACTAGTCGCGAAAGGCGGTGCCTCGAGATGATCAGAACCTCTAGGC
TACAGAAGGTTTTAAAATCCATTGACCAAATAACCAGAGAAGTTGACACACTTGTTCCCAAGGTGACATCCTTGGAAGCAACAAGCTGTGGAGGAGGGAT
AGTCGCGGAGATTGACATCGATGATCTGACAGAAGCATCGATGTCGAGACTGGTGGAGCTGGATGGGATTCTGGTAGTGGATGGAACCTTAAAGTTGCAG
AAGACAAATCAGGAAAGGAGGCTTCAGAAGTGCATAGAGACTCTTGATAAGCTGAAGCCAGAGACTTGTTCTAGCAATCAGAACAGCAAAACGAAGCAAA
GGCAAAAGCTTTCTGAAGCAGCTGTGGTCACCACCACAACCAAATGGGAAATCTTTGATTGA
AA sequence
>Lus10006328 pacid=23178336 polypeptide=Lus10006328 locus=Lus10006328.g ID=Lus10006328.BGIv1.0 annot-version=v1.0
MEEAIKSMMKVEELEIRPGGMLVQKRDSSESRNHSYSNDNSIVVPVIRVKVKFGSSYHNVSITSQASFGELKKMLAEVTKVHHQDQKLMYKKKEKDSRMF
LDIERVKDGSKLVLIEDITSRERRCLEMIRTSRLQKVLKSIDQITREVDTLVPKVTSLEATSCGGGIVAEIDIDDLTEASMSRLVELDGILVVDGTLKLQ
KTNQERRLQKCIETLDKLKPETCSSNQNSKTKQRQKLSEAAVVTTTTKWEIFD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G52060 ATBAG1 BCL-2-associated athanogene 1 ... Lus10006328 0 1
AT4G16444 unknown protein Lus10016696 4.2 0.7331
AT5G52060 ATBAG1 BCL-2-associated athanogene 1 ... Lus10029598 7.5 0.7253
AT3G14430 unknown protein Lus10030201 8.1 0.7492
AT5G42850 Thioredoxin superfamily protei... Lus10037477 8.2 0.7595
AT5G17060 ATARFB1B ADP-ribosylation factor B1B (.... Lus10020392 8.8 0.7675
AT1G50740 Transmembrane proteins 14C (.1... Lus10019624 12.2 0.7540
AT1G24625 C2H2ZnF ZFP7 zinc finger protein 7 (.1) Lus10010388 17.1 0.7127
AT4G13200 unknown protein Lus10022803 17.1 0.7376
AT3G26770 NAD(P)-binding Rossmann-fold s... Lus10041518 17.3 0.6736
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Lus10023188 21.6 0.7514

Lus10006328 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.