Lus10006329 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G41290 66 / 3e-13 SSL2 strictosidine synthase-like 2 (.1)
AT3G57030 56 / 6e-10 Calcium-dependent phosphotriesterase superfamily protein (.1)
AT3G59530 52 / 1e-08 LAP3 LESS ADHERENT POLLEN 3, Calcium-dependent phosphotriesterase superfamily protein (.1.2)
AT2G41300 49 / 2e-07 SSL1 strictosidine synthase-like 1 (.1)
AT3G57020 49 / 4e-07 Calcium-dependent phosphotriesterase superfamily protein (.1.2)
AT3G51450 47 / 7e-07 Calcium-dependent phosphotriesterase superfamily protein (.1)
AT3G57010 47 / 9e-07 Calcium-dependent phosphotriesterase superfamily protein (.1)
AT3G51430 46 / 2e-06 SSL5, YLS2 YELLOW-LEAF-SPECIFIC GENE 2, STRICTOSIDINE SYNTHASE-LIKE 5, Calcium-dependent phosphotriesterase superfamily protein (.1.2)
AT1G08470 45 / 4e-06 SSL3 strictosidine synthase-like 3 (.1)
AT5G22020 45 / 6e-06 Calcium-dependent phosphotriesterase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029599 201 / 2e-65 AT3G57030 204 / 3e-63 Calcium-dependent phosphotriesterase superfamily protein (.1)
Lus10006330 127 / 4e-36 AT3G57030 224 / 2e-70 Calcium-dependent phosphotriesterase superfamily protein (.1)
Lus10006331 121 / 8e-34 AT3G57030 239 / 1e-76 Calcium-dependent phosphotriesterase superfamily protein (.1)
Lus10029600 77 / 6e-18 AT3G57010 56 / 3e-09 Calcium-dependent phosphotriesterase superfamily protein (.1)
Lus10019148 68 / 6e-15 AT3G57030 123 / 3e-34 Calcium-dependent phosphotriesterase superfamily protein (.1)
Lus10034411 70 / 7e-15 AT3G57030 232 / 1e-74 Calcium-dependent phosphotriesterase superfamily protein (.1)
Lus10012095 57 / 3e-10 AT2G41290 291 / 2e-96 strictosidine synthase-like 2 (.1)
Lus10013370 51 / 6e-08 AT1G08470 520 / 0.0 strictosidine synthase-like 3 (.1)
Lus10008451 50 / 1e-07 AT1G08470 600 / 0.0 strictosidine synthase-like 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G037700 67 / 2e-13 AT2G41290 402 / 3e-139 strictosidine synthase-like 2 (.1)
Potri.016G037900 64 / 2e-12 AT3G57030 523 / 0.0 Calcium-dependent phosphotriesterase superfamily protein (.1)
Potri.006G040900 60 / 3e-11 AT2G41290 381 / 4e-131 strictosidine synthase-like 2 (.1)
Potri.008G109966 58 / 1e-10 AT3G57030 318 / 5e-107 Calcium-dependent phosphotriesterase superfamily protein (.1)
Potri.T015518 58 / 1e-10 AT3G57030 318 / 5e-107 Calcium-dependent phosphotriesterase superfamily protein (.1)
Potri.007G130700 52 / 1e-08 AT3G59530 662 / 0.0 LESS ADHERENT POLLEN 3, Calcium-dependent phosphotriesterase superfamily protein (.1.2)
Potri.001G214500 50 / 8e-08 AT1G08470 628 / 0.0 strictosidine synthase-like 3 (.1)
Potri.017G027600 50 / 1e-07 AT3G59530 640 / 0.0 LESS ADHERENT POLLEN 3, Calcium-dependent phosphotriesterase superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF03088 Str_synth Strictosidine synthase
Representative CDS sequence
>Lus10006329 pacid=23178345 polypeptide=Lus10006329 locus=Lus10006329.g ID=Lus10006329.BGIv1.0 annot-version=v1.0
ATGCAATGCGAGTCTTTGGAAACGGATCGGATCGGGAACGGGATCGAACATGCATCCGAAACCCACCCGTTACGTACATTAAACCGGGATGCTCAAAAAA
TAGTGACAACCCAAGACCAAACAGGGAGGGTATTCGGCTACAACCTTCTAACAAGGAACCTAGAAAGTCCAGAAATAAAGCTAGCTTTCCCCAACGGAGT
GGCACTCAACAAGGACAACTCTTACCTACTAGTAACCTTAACATCAACCAAAACAATCCTTAAATTCGAACTCAACCTCAGACACCCTTCGTATCTCGTG
CTCGCGGACAAACTTCCAGGGTTCCTCGACAACATAAGGAGGGCGCCTACTATCCCTGATGGGGAGGAACACTTCTGGGCCGGGTTGAACCCTGGCATTG
GCAATGATTGGCAATGTCTCGACCACCGGTCATGTCACCAGTACCGGTGA
AA sequence
>Lus10006329 pacid=23178345 polypeptide=Lus10006329 locus=Lus10006329.g ID=Lus10006329.BGIv1.0 annot-version=v1.0
MQCESLETDRIGNGIEHASETHPLRTLNRDAQKIVTTQDQTGRVFGYNLLTRNLESPEIKLAFPNGVALNKDNSYLLVTLTSTKTILKFELNLRHPSYLV
LADKLPGFLDNIRRAPTIPDGEEHFWAGLNPGIGNDWQCLDHRSCHQYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G41290 SSL2 strictosidine synthase-like 2 ... Lus10006329 0 1

Lus10006329 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.