Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20680 119 / 3e-34 Domain of unknown function (DUF1995) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002958 [exp] 144 / 5e-42 AT5G51920 396 / 5e-130 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G132500 [exp] 125 / 1e-36 AT3G20680 313 / 8e-106 Domain of unknown function (DUF1995) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09353 [flax] [poplar] DUF1995 Domain of unknown function (DUF1995)
Representative CDS sequence Show only first row Show all	>Lus10006345 pacid=23178349 polypeptide=Lus10006345 locus=Lus10006345.g ID=Lus10006345.BGIv1.0 annot-version=v1.0 ATGGGGCTGGAGGTTCAAGGGGTTCTGAGCAAGAGGAAAGGTGTGATCTTTAAGTCTGGGGAGGGATTATGGAATGTGCTTGTCGAAGAGGGGAACGGCG AGATGAAGGTGATTTCGCAGTTTAAAGGGAGGCCGTCGATCGATGAAGTTGAGAATGTTCTGTACAATTTGATGGCTATCAATTCTCCGATTTCGAAATC TGCCAGGTTTATTAGTGATTTAGTCTCCAATGTTACTGGAAGGAAGTGA
AA sequence Show only first row Show all	>Lus10006345 pacid=23178349 polypeptide=Lus10006345 locus=Lus10006345.g ID=Lus10006345.BGIv1.0 annot-version=v1.0 MGLEVQGVLSKRKGVIFKSGEGLWNVLVEEGNGEMKVISQFKGRPSIDEVENVLYNLMAINSPISKSARFISDLVSNVTGRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G20680			Domain of unknown function (DU...		Lus10006345 [exp]	0	1
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Lus10026198 [exp]	1.7	0.9026
AT5G01600		ATFER1	ARABIDOPSIS THALIANA FERRETIN ...		Lus10002865 [exp]	3.5	0.8769
AT1G09900			Pentatricopeptide repeat (PPR-...		Lus10037013 [exp]	4.0	0.8887
AT2G18940			Tetratricopeptide repeat (TPR)...		Lus10000036 [exp]	5.7	0.8902
AT2G28190		CZSOD2, CSD2	copper/zinc superoxide dismuta...		Lus10021410 [exp]	6.3	0.8586
AT1G20340		PETE2, DRT112	PLASTOCYANIN 2, DNA-DAMAGE-REP...		Lus10034554 [exp]	7.2	0.8969
AT1G66130			NAD(P)-binding Rossmann-fold s...		Lus10039898 [exp]	7.4	0.8815
AT3G03980			NAD(P)-binding Rossmann-fold s...		Lus10020265 [exp]	9.5	0.8731
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10012655 [exp]	12.0	0.8560
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10031587 [exp]	15.0	0.8495

Compare expression of checked genes

Lus10006345 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.