Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16740 86 / 9e-21 ATTPS03 terpene synthase 03 (.1.2) AT4G16730 86 / 1e-20 AtTPS02 terpene synthase 02 (.1) AT2G24210 84 / 4e-20 AtTPS10 terpene synthase 10 (.1) AT3G25830 74 / 2e-16 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) AT3G25820 74 / 2e-16 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1.2) AT3G25810 73 / 4e-16 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT1G61680 62 / 2e-12 ATTPS14 terpene synthase 14 (.1.2) AT1G70080 48 / 2e-07 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT3G29410 42 / 2e-05 AtTPS25 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025922 [exp] 100 / 6e-26 AT3G25810 353 / 3e-114 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10038179 [exp] 100 / 7e-26 AT3G25810 351 / 2e-113 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10001110 [exp] 100 / 8e-26 AT3G25810 362 / 1e-118 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10033643 [exp] 100 / 2e-25 AT4G16730 356 / 2e-115 terpene synthase 02 (.1) Lus10031352 [exp] 94 / 3e-24 AT3G25810 236 / 2e-73 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10018500 [exp] 89 / 7e-22 AT4G16740 419 / 1e-140 terpene synthase 03 (.1.2) Lus10018501 [exp] 83 / 1e-19 AT4G16740 413 / 1e-137 terpene synthase 03 (.1.2) Lus10039713 [exp] 77 / 1e-17 AT4G16740 409 / 4e-136 terpene synthase 03 (.1.2) Lus10018392 [exp] 69 / 9e-15 AT1G61680 350 / 1e-113 terpene synthase 14 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G041700 [exp] 95 / 7e-24 AT3G25810 432 / 3e-145 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Potri.019G023020 [exp] 92 / 2e-23 AT3G25830 440 / 1e-151 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G023006 [exp] 92 / 8e-23 AT3G25830 540 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G022338 [exp] 90 / 3e-22 AT3G25830 483 / 8e-165 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.007G118600 [exp] 87 / 2e-21 AT4G16740 462 / 3e-157 terpene synthase 03 (.1.2) Potri.019G023008 [exp] 87 / 2e-21 AT3G25830 535 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.001G308200 [exp] 81 / 6e-19 AT3G25810 499 / 4e-171 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Potri.001G308300 [exp] 78 / 5e-18 AT3G25830 507 / 4e-174 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.011G031800 [exp] 76 / 4e-17 AT3G25830 382 / 5e-126 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.007G119700 [exp] 69 / 8e-15 AT4G16740 438 / 8e-147 terpene synthase 03 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0613 [flax] [poplar] Terp_synthase PF03936 [flax] [poplar] Terpene_synth_C Terpene synthase family, metal binding domain
Representative CDS sequence Show only first row Show all	>Lus10006357 pacid=23162653 polypeptide=Lus10006357 locus=Lus10006357.g ID=Lus10006357.BGIv1.0 annot-version=v1.0 ATGACCAAGCTCACATCTCTCATCGATGTCATCGGCGATGTCTATGATATTTATGGTTCGTTGGATGAACTCCGCCTCTTCACTGGCGCCATCCAAAGGC GGGATGCAAATGAACTAGAGATGCTTCCAAAGCACATGCAGATATCCTTCATGGCCGTCTACAACACTACAAATGAACTTGCCTACCTCACCTTGATACA GCAGGATTTCAACTGTTTGCCATACATTAAACAAGCATGGCAAGATGTTCCATACCGTTGGATCTCACCAAACATTCGAGGAATATTTGGAGAACGGCCA GAATACAATAGCATCACGTCGTGTTGA
AA sequence Show only first row Show all	>Lus10006357 pacid=23162653 polypeptide=Lus10006357 locus=Lus10006357.g ID=Lus10006357.BGIv1.0 annot-version=v1.0 MTKLTSLIDVIGDVYDIYGSLDELRLFTGAIQRRDANELEMLPKHMQISFMAVYNTTNELAYLTLIQQDFNCLPYIKQAWQDVPYRWISPNIRGIFGERP EYNSITSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16730		AtTPS02	terpene synthase 02 (.1)		Lus10006357 [exp]	0	1
AT3G46290		HERK1	hercules receptor kinase 1 (.1...		Lus10012647 [exp]	2.0	0.9801
AT5G36930			Disease resistance protein (TI...		Lus10030498 [exp]	2.8	0.9801
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10027345 [exp]	3.5	0.9787
AT1G45160			Protein kinase superfamily pro...		Lus10005470 [exp]	4.5	0.9701
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10002176 [exp]	11.7	0.8909
AT2G23640		RTNLB13	Reticulan like protein B13 (.1...		Lus10039905 [exp]	13.6	0.9225
AT2G35190		NSPN11, ATNPSN1...	novel plant snare 11 (.1)		Lus10003004 [exp]	14.4	0.9746
AT5G41850			alpha/beta-Hydrolases superfam...		Lus10023100 [exp]	15.1	0.9462
					Lus10032968 [exp]	17.7	0.9674
AT1G03700			Uncharacterised protein family...		Lus10032548 [exp]	18.2	0.7912

Compare expression of checked genes

Lus10006357 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.