Lus10006371 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26730 139 / 2e-40 Fasciclin-like arabinogalactan family protein (.1)
AT5G16920 98 / 1e-24 Fasciclin-like arabinogalactan family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039146 87 / 4e-20 AT5G16920 119 / 1e-31 Fasciclin-like arabinogalactan family protein (.1)
Lus10013786 83 / 9e-19 AT5G16920 125 / 6e-34 Fasciclin-like arabinogalactan family protein (.1)
Lus10012326 44 / 1e-05 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G016700 103 / 4e-28 AT5G26730 91 / 5e-23 Fasciclin-like arabinogalactan family protein (.1)
Potri.019G049600 102 / 2e-26 AT5G16920 154 / 2e-45 Fasciclin-like arabinogalactan family protein (.1)
Potri.016G009000 64 / 8e-14 AT5G16920 57 / 1e-11 Fasciclin-like arabinogalactan family protein (.1)
PFAM info
Representative CDS sequence
>Lus10006371 pacid=23162623 polypeptide=Lus10006371 locus=Lus10006371.g ID=Lus10006371.BGIv1.0 annot-version=v1.0
ATGGCTTTCTGGATTCTCATCCTTTCCTTTCTGCCACTTCTGGCACCTTCACAAGCTCAATCATCCTCAAACTCAATCAACCAAACCGACCTCCAATTCG
CCATGGCCAACATGAGGGCAATGTCCTATCACGGATTTGTCATCCTCCTCAAGATCCTCGACAGCACCCCTGACACGCTTCACGAAGGAGAGCTGACCTT
CCTCATGCCCACCAACGACGAGCTATCAGGACTCAACCTGACAGCCGATCATCTCCACGACTTCGTTCTCAGCCACTCCATCCCGTCAGCTCTACTGCTC
ACCCACCTCCTGCATTTCCCCAACGGATCACTGGTACCATCCGGTAGCCCGAACAAGCTGCTGAGAATCACTAACAGCCGCAGATCGGGACTGTTCGTGA
ACAATGCCAGAATCACCACTCCGAATGTCTGTCTCAACTCTATGATCAAGTGCCATGGAGTCGACGCTGCCATTACATTTGACGACAGTGATTCTTCTCC
TCCTTCTGCCGCATCTTTCGTAACGCTTGATCTCAGCCTCAATGTTCGTACTCCAAAGTGGCCGGTATCTGCGAATTCTGCCTCTGATGCAGGATCTTCC
TCGTCCTTGCATCTGGATAATATCCCTGCACCGCACTGA
AA sequence
>Lus10006371 pacid=23162623 polypeptide=Lus10006371 locus=Lus10006371.g ID=Lus10006371.BGIv1.0 annot-version=v1.0
MAFWILILSFLPLLAPSQAQSSSNSINQTDLQFAMANMRAMSYHGFVILLKILDSTPDTLHEGELTFLMPTNDELSGLNLTADHLHDFVLSHSIPSALLL
THLLHFPNGSLVPSGSPNKLLRITNSRRSGLFVNNARITTPNVCLNSMIKCHGVDAAITFDDSDSSPPSAASFVTLDLSLNVRTPKWPVSANSASDAGSS
SSLHLDNIPAPH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26730 Fasciclin-like arabinogalactan... Lus10006371 0 1
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10030934 4.0 0.7190
AT4G17720 RNA-binding (RRM/RBD/RNP motif... Lus10030952 10.5 0.6938
AT3G12580 ATHSP70, HSP70 ARABIDOPSIS HEAT SHOCK PROTEIN... Lus10023419 14.2 0.7147
AT5G28470 Major facilitator superfamily ... Lus10024345 14.3 0.7066
AT5G59730 ATEXO70H7 exocyst subunit exo70 family p... Lus10005436 19.3 0.7052
AT1G47480 alpha/beta-Hydrolases superfam... Lus10034068 20.6 0.6931
AT1G24110 Peroxidase superfamily protein... Lus10010716 24.3 0.6894
AT3G62260 Protein phosphatase 2C family ... Lus10009993 29.2 0.6760
AT5G27740 RFC3, EMB251, E... replication factor C 3, EMBRYO... Lus10041764 36.7 0.6741
AT3G14130 Aldolase-type TIM barrel famil... Lus10008133 38.5 0.6391

Lus10006371 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.