Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012338 [exp] 77 / 6e-19 AT5G35770 49 / 3e-07 STERILE APETALA, Transducin/WD40 repeat-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G166400 [exp] 63 / 1e-12 AT5G35770 484 / 1e-169 STERILE APETALA, Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006385 pacid=23162629 polypeptide=Lus10006385 locus=Lus10006385.g ID=Lus10006385.BGIv1.0 annot-version=v1.0 ATGTCTTCTTCTCTTCCTCCTCTTCCTTCATCCTCTTCATCCTCATCCTCCTCCGGCAACGACAATAACCATGACGGCGGTGGCGGTGCAAGGGTAGTTG GTTCCTCCGCCGGGAGAGGTGACGACTACGAAGGGCCGTCGAGGTCCAGGCCGCGTGGCGTTTACGAAGTGTGGCCGGAGCCTTTCTTGGAAGCACTCGC TACCCACATCGCCGCCGACGCTGCCCTCTTCTCCGGCCGCCTCTCCGCCGCTCAGGCTCTCTCCAATGTCTTCCAGGTACCTCGTCATTTTGGCCAACTT AACTTCTCCCTTGACGCTTAA
AA sequence Show only first row Show all	>Lus10006385 pacid=23162629 polypeptide=Lus10006385 locus=Lus10006385.g ID=Lus10006385.BGIv1.0 annot-version=v1.0 MSSSLPPLPSSSSSSSSSGNDNNHDGGGGARVVGSSAGRGDDYEGPSRSRPRGVYEVWPEPFLEALATHIAADAALFSGRLSAAQALSNVFQVPRHFGQL NFSLDA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G35770		SAP	STERILE APETALA, Transducin/WD...		Lus10006385 [exp]	0	1
AT1G10710		PHS1	poor homologous synapsis 1 (.1...		Lus10004624 [exp]	8.9	0.7721
AT5G49180			Plant invertase/pectin methyle...		Lus10003968 [exp]	23.4	0.7341
AT5G20240	MADS	PI, PISTILLATA	PISTILLATA, K-box region and M...		Lus10042749 [exp]	25.5	0.7464
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10036927 [exp]	34.4	0.7554
AT1G70790			Calcium-dependent lipid-bindin...		Lus10034591 [exp]	35.5	0.7344
AT1G02335		GL22	germin-like protein subfamily ...		Lus10023350 [exp]	38.1	0.7550
AT5G44940			F-box/RNI-like superfamily pro...		Lus10000726 [exp]	41.8	0.7550
AT5G61850	LFY	LFY3, LFY	LEAFY 3, floral meristem ident...		Lus10016732 [exp]	54.0	0.7406
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10010759 [exp]	58.1	0.7394
AT2G01905		CYCJ18	cyclin J18 (.1)		Lus10031940 [exp]	82.2	0.6993

Compare expression of checked genes

Lus10006385 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.