Lus10006392 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07720 118 / 6e-34 Galactose oxidase/kelch repeat superfamily protein (.1)
AT5G48180 89 / 1e-22 NSP5 nitrile specifier protein 5 (.1)
AT3G16400 78 / 2e-18 ATNSP1, ATMLP-470 MYROSINASE-BINDING PROTEIN-LIKE PROTEIN-470, nitrile specifier protein 1 (.1.2)
AT2G33070 77 / 3e-18 NSP2, ATNSP2 NITRILE-SPECIFIER PROTEIN 2, nitrile specifier protein 2 (.1.2.3)
AT3G16410 76 / 9e-18 NSP4 nitrile specifier protein 4 (.1)
AT3G16390 72 / 1e-16 NSP3 nitrile specifier protein 3 (.1)
AT1G54040 70 / 4e-16 TASTY, ESP, ESR EPITHIOSPECIFYING SENESCENCE REGULATOR, epithiospecifier protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012345 78 / 2e-20 AT3G07720 69 / 4e-15 Galactose oxidase/kelch repeat superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G168300 122 / 1e-35 AT3G07720 484 / 1e-173 Galactose oxidase/kelch repeat superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10006392 pacid=23162644 polypeptide=Lus10006392 locus=Lus10006392.g ID=Lus10006392.BGIv1.0 annot-version=v1.0
ATGGGTGCCGGAAAATTTACAGGGGAAGCCTATGCGTTGGATACGGAGACTTTGCTGTGGAAGCGGCTGGACGATGGGGCGAGCTCCGAGAAACATCCTG
GTCCTCGAGGATGGTGCGCTTATGCCGCGGGGGAGCTCGAGGGGGAGAAGGGCTTGTTGGTGTACGGTGGGAATTCTCCTAGCAATGATAGGCTTGGTGA
CTTGTTCTTCTTCACTCCTTCCTTGGTGGCCATTGGTAACTAG
AA sequence
>Lus10006392 pacid=23162644 polypeptide=Lus10006392 locus=Lus10006392.g ID=Lus10006392.BGIv1.0 annot-version=v1.0
MGAGKFTGEAYALDTETLLWKRLDDGASSEKHPGPRGWCAYAAGELEGEKGLLVYGGNSPSNDRLGDLFFFTPSLVAIGN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07720 Galactose oxidase/kelch repeat... Lus10006392 0 1
AT4G13530 unknown protein Lus10041074 3.2 0.8733
AT3G14280 unknown protein Lus10037453 3.2 0.8454
AT1G27300 unknown protein Lus10015771 5.5 0.8437
AT3G24535 unknown protein Lus10023639 6.0 0.8401
AT4G38690 PLC-like phosphodiesterases su... Lus10034483 6.9 0.7986
AT5G67190 AP2_ERF DEAR2 DREB and EAR motif protein 2 (... Lus10009373 10.4 0.8187
AT5G63910 FCLY farnesylcysteine lyase (.1) Lus10010948 10.5 0.8398
AT5G43180 Protein of unknown function, D... Lus10025217 13.3 0.7686
AT1G24450 NFD2 NUCLEAR FUSION DEFECTIVE 2, Ri... Lus10042133 18.7 0.7948
AT4G36750 Quinone reductase family prote... Lus10041718 20.2 0.7859

Lus10006392 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.