Lus10006401 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012353 46 / 2e-06 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10006401 pacid=23162652 polypeptide=Lus10006401 locus=Lus10006401.g ID=Lus10006401.BGIv1.0 annot-version=v1.0
ATGGCCACCGTTGAGGTTGTATCGGCGCAAACCGCATTCCATGAGGAGAAACCCGCGGAAATAGCGGCGGCCGTCAAGGTTCAAGAGCAGGAGGAGCCAC
CGGCTGAGGTGGCGGCGGATTCAACTCCTCCTCCTCCTTCTTCTCCTGCTCCGGTGGCTTCAGAAGAGCCAGAGAAGGAAGAAGAGAAGAAGGAGATCAC
CACCGCTGACAAAGAAGAAGCAGCTGACGTGGTTCCCGAACAAGTTGAAGAGGTAGTTGTTGAGACCACGAAAGAGGTGGTCGTGGCTGAAGAAACAGAA
CCTGAAGAAGAAGAAGAAGAAGAAGAAGAAGTGGAGAAGAAACCCGTTGATTTTGAAGAGGAAACCATGGTGGAGGAGCCTGCCGTCATTTCTGTCGAGG
AGGCATCGGCGGTTGAGCCAGTGACGGTAGACGAACCAGCTGCCGGGCCCGGCGAAGGTGCTCCGGAGGAGAAGAAGGTGGTTCCGGTGGTGAAGACTGA
GTGA
AA sequence
>Lus10006401 pacid=23162652 polypeptide=Lus10006401 locus=Lus10006401.g ID=Lus10006401.BGIv1.0 annot-version=v1.0
MATVEVVSAQTAFHEEKPAEIAAAVKVQEQEEPPAEVAADSTPPPPSSPAPVASEEPEKEEEKKEITTADKEEAADVVPEQVEEVVVETTKEVVVAEETE
PEEEEEEEEEVEKKPVDFEEETMVEEPAVISVEEASAVEPVTVDEPAAGPGEGAPEEKKVVPVVKTE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10006401 0 1
AT4G24910 Protein of unknown function (D... Lus10003160 6.0 0.9395
AT4G24910 Protein of unknown function (D... Lus10002345 8.5 0.9372
AT1G44960 SNARE associated Golgi protein... Lus10006050 8.9 0.8899
AT4G23610 Late embryogenesis abundant (L... Lus10027179 9.0 0.9360
AT1G24620 EF hand calcium-binding protei... Lus10028913 10.6 0.9270
AT3G52760 Integral membrane Yip1 family ... Lus10017054 10.9 0.9272
AT2G17270 PHT3;3 phosphate transporter 3;3 (.1) Lus10035975 12.7 0.9287
Lus10008008 12.8 0.8411
AT2G28790 Pathogenesis-related thaumatin... Lus10040843 16.3 0.9188
AT5G17050 UGT78D2 UDP-glucosyl transferase 78D2 ... Lus10025854 17.1 0.9339

Lus10006401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.