Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G35732 79 / 2e-20 unknown protein AT2G04795 72 / 9e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012359 [exp] 125 / 1e-37 AT5G35732 / unknown protein Lus10002270 [exp] 93 / 1e-25 AT5G35732 57 / 1e-11 unknown protein Lus10001730 [exp] 89 / 4e-24 AT5G35732 50 / 6e-09 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G222900 [exp] 107 / 8e-32 AT5G35732 102 / 2e-29 unknown protein Potri.014G162400 [exp] 102 / 2e-29 AT5G35732 96 / 5e-27 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006404 pacid=23162666 polypeptide=Lus10006404 locus=Lus10006404.g ID=Lus10006404.BGIv1.0 annot-version=v1.0 ATGTTTCGAACGCTGGCGAGATTGCGGAGGAACATAAGGAAGAGCCCTAGGGTAGCTGATGAGAGCATTTTGGGGGGAGGAGGAGGAGGAGGGATGAACA TGAGAGTAGTAGTAGTTGGTGATGATCATCATCAACAACAAGCGCACGCGTTAAACAAGTTCTCGACGGTGGTGAGCATGGTCCTAGTGCCGTTTTCGAT CTTTGCTTGCCTGTCGCAACCTCATGTCAATGGGGCAGACGGGATGTGGGCATCCGCGGAGCTTCCACAGCTCTCGGAGGTCAACCATCTAATGGTCAAT GATAGCATGAGGTATGCAATACTTATGTAG
AA sequence Show only first row Show all	>Lus10006404 pacid=23162666 polypeptide=Lus10006404 locus=Lus10006404.g ID=Lus10006404.BGIv1.0 annot-version=v1.0 MFRTLARLRRNIRKSPRVADESILGGGGGGGMNMRVVVVGDDHHQQQAHALNKFSTVVSMVLVPFSIFACLSQPHVNGADGMWASAELPQLSEVNHLMVN DSMRYAILM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G35732			unknown protein		Lus10006404 [exp]	0	1
AT3G03980			NAD(P)-binding Rossmann-fold s...		Lus10020265 [exp]	1.4	0.9275
					Lus10011339 [exp]	2.0	0.9054
AT3G09770		LOG2	LOSS OF GDU 2, RING/U-box supe...		Lus10037412 [exp]	2.8	0.8911
AT1G08290	C2H2ZnF	WIP3	WIP domain protein 3 (.1)		Lus10020597 [exp]	3.0	0.8930
AT2G01620		MEE11	maternal effect embryo arrest ...		Lus10007930 [exp]	4.5	0.8896
AT3G48560		TZP5, IMR1, ALS...	TRIAZOLOPYRIMIDINE RESISTANT 5...		Lus10035359 [exp]	4.6	0.8821
					Lus10003135 [exp]	4.9	0.8837
AT3G58840		PMD1	peroxisomal and mitochondrial ...		Lus10010937 [exp]	5.5	0.8715
AT1G07530	GRAS	SCL14, ATGRAS2	GRAS \(GAI, RGA, SCR\) 2, ARAB...		Lus10016519 [exp]	5.7	0.8699
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10016497 [exp]	5.8	0.8689

Compare expression of checked genes

Lus10006404 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.