Lus10006406 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04842 202 / 7e-63 EMB2761 EMBRYO DEFECTIVE 2761, threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative (.1)
AT5G26830 77 / 4e-17 Threonyl-tRNA synthetase (.1)
AT1G17960 70 / 1e-14 Threonyl-tRNA synthetase (.1)
AT1G18130 63 / 3e-13 Class II aaRS and biotin synthetases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012360 232 / 1e-73 AT2G04842 1035 / 0.0 EMBRYO DEFECTIVE 2761, threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative (.1)
Lus10030645 82 / 5e-19 AT5G26830 946 / 0.0 Threonyl-tRNA synthetase (.1)
Lus10030841 81 / 2e-18 AT5G26830 1007 / 0.0 Threonyl-tRNA synthetase (.1)
Lus10005351 77 / 4e-17 AT5G26830 1088 / 0.0 Threonyl-tRNA synthetase (.1)
Lus10021402 77 / 5e-17 AT5G26830 1093 / 0.0 Threonyl-tRNA synthetase (.1)
Lus10030843 51 / 4e-08 AT5G26830 248 / 2e-77 Threonyl-tRNA synthetase (.1)
Lus10030644 48 / 8e-08 AT1G17960 150 / 3e-44 Threonyl-tRNA synthetase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G162200 218 / 2e-68 AT2G04842 1089 / 0.0 EMBRYO DEFECTIVE 2761, threonyl-tRNA synthetase, putative / threonine--tRNA ligase, putative (.1)
Potri.008G145600 78 / 1e-17 AT5G26830 1100 / 0.0 Threonyl-tRNA synthetase (.1)
Potri.010G096500 76 / 9e-17 AT5G26830 827 / 0.0 Threonyl-tRNA synthetase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0458 IIaaRS-ABD PF03129 HGTP_anticodon Anticodon binding domain
Representative CDS sequence
>Lus10006406 pacid=23162664 polypeptide=Lus10006406 locus=Lus10006406.g ID=Lus10006406.BGIv1.0 annot-version=v1.0
ATGATCCACAGAGCGGTACTTGGATCTTTAGAACGGTTTTTCGGAGTCCTCATAGAGCATTATGCTGGGGACTTAGATCATTATGCCGGGGACTTCCCGC
TGTGGCTTGCCCCGGTACAAGTACGAATACTGCCAGTAACCGATACACAGCTTGACTACTGCCGCAAAATCGCCAGCGAACTGAAGCAGCATGGCATTCG
AGCTGAACTCTGCCATGGGGAAAGGCTGCCTAAGCTTATAAGGAATGCAGAGAAGCAGAAAACTCCCCTGATGGCGGTGGTTGGTCCTAAGGAAGTTGAG
ACGCAAACAGTCACAGTTAGATCTAGGTTTGCTGGGGAACTGGGGACCTTGGAAATTGACGATTTTATCGGCAAAATCAAGAATGTCTGTGATAATAGAA
GTTCACTGTGA
AA sequence
>Lus10006406 pacid=23162664 polypeptide=Lus10006406 locus=Lus10006406.g ID=Lus10006406.BGIv1.0 annot-version=v1.0
MIHRAVLGSLERFFGVLIEHYAGDLDHYAGDFPLWLAPVQVRILPVTDTQLDYCRKIASELKQHGIRAELCHGERLPKLIRNAEKQKTPLMAVVGPKEVE
TQTVTVRSRFAGELGTLEIDDFIGKIKNVCDNRSSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G04842 EMB2761 EMBRYO DEFECTIVE 2761, threony... Lus10006406 0 1
AT4G24090 unknown protein Lus10017325 2.4 0.8800
AT1G74410 RING/U-box superfamily protein... Lus10021628 3.2 0.8884
AT2G38570 unknown protein Lus10014180 5.6 0.8921
AT1G69550 disease resistance protein (TI... Lus10005807 6.9 0.8080
AT2G22360 DNAJ heat shock family protein... Lus10025742 7.7 0.8381
AT4G33490 Eukaryotic aspartyl protease f... Lus10020874 7.7 0.8187
AT5G38510 Rhomboid-related intramembrane... Lus10000628 11.5 0.8646
AT5G50920 CLPC1, CLPC, AT... HEAT SHOCK PROTEIN 93-V, DE-RE... Lus10043196 15.2 0.8168
Lus10033476 16.2 0.8488
AT5G19940 Plastid-lipid associated prote... Lus10042448 16.4 0.8612

Lus10006406 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.