Lus10006409 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G04740 114 / 3e-30 ankyrin repeat family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012362 171 / 3e-51 AT2G04740 831 / 0.0 ankyrin repeat family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G163200 137 / 2e-38 AT2G04740 827 / 0.0 ankyrin repeat family protein (.1)
PFAM info
Representative CDS sequence
>Lus10006409 pacid=23162660 polypeptide=Lus10006409 locus=Lus10006409.g ID=Lus10006409.BGIv1.0 annot-version=v1.0
ATGCCTCCGCATACCATGGACCCAATCGACCTCGACGCTTCCGATTTCAACTCATCCCTTCGCCTCAAGAAGGTCCCCAACGGCGACGTCTTCGAAGCCT
CCCGTGCCGGCGACGTCGACCGCCTCCGCTACCACTTAGAATCCGGCGTCAACGTCAACGCCCGGGACCAATGGGATTCCGTCGCCTTGTGCCACTATGC
CGCCTTGAATTTGAAAGTCAGGAAGCTTTTGAAAGCATTCGAAGCTCGTCCGCCTCCTTTAGGTCCTCTGCCCGCCGCCTTGAGTGATGTTTTCTTGAGT
TGCGCCGCCAATAGGGCGTATTTGCAGCTTGTTGAAGGCACCAACTTGTGGGAGGCTATCAGAAGAGGAGAAGAACAGCAGGAGCTGCACATTATCCAGA
GAAGGAAATGCATTACCGTTGGAAGAAGATGA
AA sequence
>Lus10006409 pacid=23162660 polypeptide=Lus10006409 locus=Lus10006409.g ID=Lus10006409.BGIv1.0 annot-version=v1.0
MPPHTMDPIDLDASDFNSSLRLKKVPNGDVFEASRAGDVDRLRYHLESGVNVNARDQWDSVALCHYAALNLKVRKLLKAFEARPPPLGPLPAALSDVFLS
CAANRAYLQLVEGTNLWEAIRRGEEQQELHIIQRRKCITVGRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G04740 ankyrin repeat family protein ... Lus10006409 0 1
AT3G21460 Glutaredoxin family protein (.... Lus10012815 15.1 0.7139
AT3G13790 ATCWINV1, ATBFR... ARABIDOPSIS THALIANA CELL WALL... Lus10015613 15.5 0.6945
AT5G03680 Trihelix PTL PETAL LOSS, Duplicated homeodo... Lus10027718 17.4 0.7125
AT2G40080 ELF4 EARLY FLOWERING 4, Protein of ... Lus10028288 44.8 0.6332
AT5G12180 CPK17 calcium-dependent protein kina... Lus10023346 51.5 0.6316
AT5G66350 SHI SHORT INTERNODES, Lateral root... Lus10028794 65.7 0.5648
AT5G28210 mRNA capping enzyme family pro... Lus10040496 79.1 0.5897
AT3G03450 GRAS RGL2 RGA-like 2 (.1) Lus10016893 83.2 0.5948
AT1G05370 Sec14p-like phosphatidylinosit... Lus10021919 110.8 0.5710
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10019652 113.3 0.5898

Lus10006409 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.