Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27950 126 / 7e-37 LTPG1 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) AT2G44290 72 / 1e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 68 / 4e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G58550 58 / 9e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 52 / 2e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 47 / 1e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 46 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 45 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G43720 45 / 6e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G05960 43 / 1e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011358 [exp] 219 / 1e-73 AT1G27950 103 / 5e-28 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10037027 [exp] 163 / 2e-51 AT1G27950 147 / 3e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10015779 [exp] 152 / 7e-47 AT1G27950 144 / 8e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10033076 [exp] 74 / 2e-16 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017749 [exp] 73 / 5e-16 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10035975 [exp] 68 / 2e-13 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1) Lus10014681 [exp] 61 / 1e-11 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042449 [exp] 57 / 5e-10 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10021912 [exp] 53 / 1e-08 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G056200 [exp] 145 / 3e-44 AT1G27950 149 / 1e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.003G172400 [exp] 142 / 5e-43 AT1G27950 145 / 5e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.001G232000 [exp] 68 / 2e-14 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G195700 [exp] 57 / 2e-10 AT2G44290 145 / 6e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 56 / 7e-10 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 55 / 1e-09 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G008500 [exp] 54 / 5e-09 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G054000 [exp] 50 / 8e-08 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G053700 [exp] 50 / 8e-08 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G217000 [exp] 49 / 2e-07 AT1G55260 149 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10006413 pacid=23171997 polypeptide=Lus10006413 locus=Lus10006413.g ID=Lus10006413.BGIv1.0 annot-version=v1.0 ATGAAACCCACTAGTTTCCTCCTCCTCATCTGCCTTTCCCTCACCGCCGCTTCCGCCGTCACTCATGAAGGCTCCGACGACAATCTGGCGAAGGACTGCA GCAAGGAGATCCAAGGGGTGATGCCATGCTTGGCGTTTGCACAAGGCAAGCAAGCTTCACCTTCCAAAGAGTGCTGTGACAACACCAAAGCCACCAAGGA GAACAAGCCCAAGTGCTTATGTTACATCATGATGCAGACTCACAACGGTGGTTCTCAGTTCAGGAGCCTCGGCGTGCAGGAGGCTAAGTTGATTCAGCTC CCTTCCACTTGCCAGCTCGCCAACGCCAGCGTTAGCTACTGCCCAGGACTCCTTGGCTTAGCTCCAAACTCGCCGGAGGCAGCCATATTCACCAACGCTT CTACGGCGACGGCGACGCCGGCTACATCGACATCAGCGACGCCGCTCCCAGGAGGGAGCTCCGGTGGGTCCAAACACCGACCTGATTTTGTCGCCGGCTC TTGGGGGGTTGCATTTGTTTTCTTCTACGGTTTGGTCGTCTCCGTCTTCACTGCGATCTGA
AA sequence Show only first row Show all	>Lus10006413 pacid=23171997 polypeptide=Lus10006413 locus=Lus10006413.g ID=Lus10006413.BGIv1.0 annot-version=v1.0 MKPTSFLLLICLSLTAASAVTHEGSDDNLAKDCSKEIQGVMPCLAFAQGKQASPSKECCDNTKATKENKPKCLCYIMMQTHNGGSQFRSLGVQEAKLIQL PSTCQLANASVSYCPGLLGLAPNSPEAAIFTNASTATATPATSTSATPLPGGSSGGSKHRPDFVAGSWGVAFVFFYGLVVSVFTAI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Lus10006413 [exp]	0	1
AT1G75900		EXL3	GDSL-like Lipase/Acylhydrolase...		Lus10003717 [exp]	1.4	0.9776
AT1G32780			GroES-like zinc-binding dehydr...		Lus10033241 [exp]	1.4	0.9670
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10040873 [exp]	4.7	0.9401
AT3G21090		ABCG15	ATP-binding cassette G15, ABC-...		Lus10009959 [exp]	6.3	0.9464
AT2G18300	bHLH	bHLH064, HBI1	basic helix-loop-helix (bHLH) ...		Lus10026008 [exp]	6.9	0.9547
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009628 [exp]	8.1	0.9525
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10011997 [exp]	8.1	0.9590
AT1G60010			unknown protein		Lus10010708 [exp]	8.2	0.9329
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009001 [exp]	8.5	0.9421
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009623 [exp]	8.8	0.9359

Compare expression of checked genes

Lus10006413 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.