Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60245 139 / 7e-45 Zinc-binding ribosomal protein family protein (.1) AT3G10950 139 / 8e-45 Zinc-binding ribosomal protein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011359 [exp] 154 / 9e-51 AT3G10950 168 / 4e-56 Zinc-binding ribosomal protein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G140100 [exp] 144 / 1e-46 AT3G10950 174 / 2e-58 Zinc-binding ribosomal protein family protein (.1) Potri.001G149300 [exp] 144 / 2e-46 AT3G10950 176 / 3e-59 Zinc-binding ribosomal protein family protein (.1) Potri.003G085100 [exp] 144 / 2e-46 AT3G10950 176 / 3e-59 Zinc-binding ribosomal protein family protein (.1) Potri.014G052400 [exp] 144 / 2e-46 AT3G10950 176 / 3e-59 Zinc-binding ribosomal protein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF01780 [flax] [poplar] Ribosomal_L37ae Ribosomal L37ae protein family
Representative CDS sequence Show only first row Show all	>Lus10006414 pacid=23171977 polypeptide=Lus10006414 locus=Lus10006414.g ID=Lus10006414.BGIv1.0 annot-version=v1.0 ATGACTAAAAGAACCAAGAAGGTTGGAATCGTCGGCAAATATGGTACCCGTTATGGTGCTAGTTTGAGGAAGCAGATTAAGAAGATGGAAATCAGCCAGC ACAGGAAGTACTTCTGTGAGTTCTGCGGCAAGGATGCCGTGAAGAGAAAGGCCGTTGGAATCTGGGGTTGCAAGGGCTGTGGCAAGGTGAAAGCTGGAGG TGCTTACACCATGAACACCGCAAGTGCAGTGACCGTGAGGAGTACCATCCGTCGATTGAGGGAGCAGACCGAGAGTTAG
AA sequence Show only first row Show all	>Lus10006414 pacid=23171977 polypeptide=Lus10006414 locus=Lus10006414.g ID=Lus10006414.BGIv1.0 annot-version=v1.0 MTKRTKKVGIVGKYGTRYGASLRKQIKKMEISQHRKYFCEFCGKDAVKRKAVGIWGCKGCGKVKAGGAYTMNTASAVTVRSTIRRLREQTES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G10950			Zinc-binding ribosomal protein...		Lus10006414 [exp]	0	1
AT2G19730			Ribosomal L28e protein family ...		Lus10037609 [exp]	1.0	0.9174
AT3G10950			Zinc-binding ribosomal protein...		Lus10011359 [exp]	1.4	0.9123
AT2G19730			Ribosomal L28e protein family ...		Lus10006869 [exp]	2.4	0.8722
AT2G09990			Ribosomal protein S5 domain 2-...		Lus10009252 [exp]	4.8	0.8292
AT3G16780			Ribosomal protein L19e family ...		Lus10023388 [exp]	5.3	0.8443
AT4G15000			Ribosomal L27e protein family ...		Lus10027314 [exp]	5.3	0.8720
AT2G31610			Ribosomal protein S3 family pr...		Lus10033442 [exp]	5.9	0.8694
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10035401 [exp]	6.0	0.8500
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10031002 [exp]	6.9	0.8573
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Lus10027926 [exp]	8.5	0.8547

Compare expression of checked genes

Lus10006414 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.