Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006417 pacid=23172010 polypeptide=Lus10006417 locus=Lus10006417.g ID=Lus10006417.BGIv1.0 annot-version=v1.0 ATGGTTTCTCAGCCACGGCCGCATGAGTTAATGGAAACGTATTCTTACATCTCTAAAGCTGACTTAAACTCCACGGAGAAGATAATGAATCATCTGGAAA AGTATGGTATTGATCATGTAACCAATCCGTACGCGTGTGCTCCTAATGGTATGCTAAGCCATAACTCAGTAGTGCATCCTCATTTGAACTCAACTCCATT TCATGTGGGTTTGGAGGTAGTTTGTTGTTTGCTGGTTTTGTGGGCAGAGATCTCGTACCGGAGATGA
AA sequence Show only first row Show all	>Lus10006417 pacid=23172010 polypeptide=Lus10006417 locus=Lus10006417.g ID=Lus10006417.BGIv1.0 annot-version=v1.0 MVSQPRPHELMETYSYISKADLNSTEKIMNHLEKYGIDHVTNPYACAPNGMLSHNSVVHPHLNSTPFHVGLEVVCCLLVLWAEISYRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006417 [exp]	0	1
AT4G37070		AtPLAIVA, PLP1,...	phospholipase A IVA, Acyl tran...		Lus10019637 [exp]	3.5	0.9673
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Lus10015169 [exp]	5.2	0.9659
AT4G37070		AtPLAIVA, PLP1,...	phospholipase A IVA, Acyl tran...		Lus10000279 [exp]	5.3	0.9666
AT1G14280		PKS2	phytochrome kinase substrate 2...		Lus10012831 [exp]	6.3	0.9648
AT3G18060			transducin family protein / WD...		Lus10032444 [exp]	7.9	0.9276
AT1G17200			Uncharacterised protein family...		Lus10042471 [exp]	8.4	0.9559
AT1G01180			S-adenosyl-L-methionine-depend...		Lus10030709 [exp]	10.7	0.9541
					Lus10008816 [exp]	11.2	0.9512
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Lus10023913 [exp]	11.6	0.9443
AT5G28010			Polyketide cyclase/dehydrase a...		Lus10039891 [exp]	12.6	0.9430

Compare expression of checked genes

Lus10006417 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.