Lus10006419 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G27080 164 / 2e-51 TOM20-3 translocase of outer membrane 20 kDa subunit 3 (.1)
AT5G40930 153 / 4e-47 TOM20-4 translocase of outer membrane 20-4 (.1)
AT1G27390 153 / 7e-47 TOM20-2 translocase outer membrane 20-2 (.1)
AT3G27070 127 / 4e-37 TOM20-1 translocase outer membrane 20-1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011363 342 / 3e-121 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10012532 161 / 7e-46 AT3G01910 616 / 0.0 sulfite oxidase (.1.2.3)
Lus10035211 143 / 1e-42 AT3G27080 210 / 1e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10032045 140 / 1e-41 AT3G27080 211 / 2e-69 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10041558 68 / 3e-14 AT3G27080 83 / 5e-20 translocase of outer membrane 20 kDa subunit 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G330200 177 / 1e-56 AT1G27390 215 / 3e-71 translocase outer membrane 20-2 (.1)
Potri.001G054900 174 / 2e-55 AT1G27390 230 / 4e-77 translocase outer membrane 20-2 (.1)
Potri.003G173400 174 / 2e-55 AT3G27080 208 / 2e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF06552 TOM20_plant Plant specific mitochondrial import receptor subunit TOM20
Representative CDS sequence
>Lus10006419 pacid=23172009 polypeptide=Lus10006419 locus=Lus10006419.g ID=Lus10006419.BGIv1.0 annot-version=v1.0
ATGGAGTTCACTCAAGAAGACTTCGATCGCCTCCTGTTCATGGAGCACGCCCGACAGACGGCCGAATCCAGCTACGCCAAGGACCCTAAAAACGCCGATA
ACTTGACCAAGTGGGGAGCAGCGTTGCTTCAGCTCTCTCAATTGGAGAAAGGCCCTGCCGCGGTCACTCAGATGCTTGATGAGGCGATGTTGAGATTCGA
GGAGGCGTTGGGGATAAATCCACGGAAGCATGAAGCTTTATGGGGGATGGGGAACGCGAACACAAATTATGCGTTTTTATCTCCTGATCAAGCTGAAGCA
GGACAACGATTTCATATGGCTGCTGAGTTTTATCAGCGAGCTCTTGACGAGGCTCCGGATAATCCGATATATCACCAGTCTTTGATGGAGGTTGCTAAGG
CACCGGAGCTGCATCGTCAGGCTTTTGAGCAGATGGCTGCTGCTGCAACATCTAAGGGTTCGAAGAAGAAGAAGAGTAGGAAGACTGAGGATTTGATGTA
TGACGTATGTGGCTGGGTTATACTTGCCGCCGGAGTTGCCGCCTTACTGTCAAAGTCCTATAATAACCCGCCGCCGCCTCCGTCTCCACATTTCTAA
AA sequence
>Lus10006419 pacid=23172009 polypeptide=Lus10006419 locus=Lus10006419.g ID=Lus10006419.BGIv1.0 annot-version=v1.0
MEFTQEDFDRLLFMEHARQTAESSYAKDPKNADNLTKWGAALLQLSQLEKGPAAVTQMLDEAMLRFEEALGINPRKHEALWGMGNANTNYAFLSPDQAEA
GQRFHMAAEFYQRALDEAPDNPIYHQSLMEVAKAPELHRQAFEQMAAAATSKGSKKKKSRKTEDLMYDVCGWVILAAGVAALLSKSYNNPPPPPSPHF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G27080 TOM20-3 translocase of outer membrane ... Lus10006419 0 1
AT4G20020 unknown protein Lus10035806 4.5 0.8445
AT2G15000 unknown protein Lus10025365 5.1 0.8329
AT3G22330 ATRH53, PMH2 putative mitochondrial RNA hel... Lus10035410 6.9 0.8157
AT5G52630 MEF1 mitochondrial RNAediting facto... Lus10011323 8.8 0.8100
AT3G55605 Mitochondrial glycoprotein fam... Lus10030157 11.7 0.8105
AT5G62300 Ribosomal protein S10p/S20e fa... Lus10031705 12.7 0.7702
AT3G55605 Mitochondrial glycoprotein fam... Lus10001015 13.0 0.8038
AT2G21060 ATCSP4, ATGRP2B COLD SHOCK DOMAIN PROTEIN 4, g... Lus10027839 15.0 0.8102
AT3G55605 Mitochondrial glycoprotein fam... Lus10001017 15.9 0.8076
AT4G31580 SRZ22, RSZP22, ... RS-containing zinc finger prot... Lus10012994 18.0 0.7712

Lus10006419 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.