Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G40042 66 / 6e-16 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) AT2G22425 60 / 2e-13 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1), Microsomal signal peptidase 12 kDa subunit (SPC12) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011365 [exp] 105 / 2e-31 AT4G40042 75 / 2e-19 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10037014 [exp] 77 / 3e-20 AT4G40042 131 / 2e-41 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10037011 [exp] 77 / 4e-20 AT4G40042 127 / 1e-39 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1) Lus10015793 [exp] 74 / 5e-19 AT4G40042 127 / 2e-39 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G175775 [exp] 77 / 3e-20 AT2G22425 124 / 1e-38 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1), Microsomal signal peptidase 12 kDa subunit (SPC12) (.2) Potri.010G059300 [exp] 67 / 3e-16 AT4G40042 119 / 7e-37 Microsomal signal peptidase 12 kDa subunit (SPC12) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06645 [flax] [poplar] SPC12 Microsomal signal peptidase 12 kDa subunit (SPC12)
Representative CDS sequence Show only first row Show all	>Lus10006422 pacid=23171979 polypeptide=Lus10006422 locus=Lus10006422.g ID=Lus10006422.BGIv1.0 annot-version=v1.0 ATGGATCGGCAAGGGCAGAAGCTAGCCGGGAGGCTTCTGCAGCTGACGCTATTCGCCTTCGCAGTTATGGCGTTCTTCACCGGCTACATCATGGGATCCT TCCACACGGTGTTCTTGATCTACGGCGGCGGACTCTTCCTCGCCGCCTTAATCGTCCTCCCCAACTGGCCTTTCTCAGGAAATCCGCCGCCGCAGCCCCC CGCCGCCACTCGCGCCAAACAAAGCTAA
AA sequence Show only first row Show all	>Lus10006422 pacid=23171979 polypeptide=Lus10006422 locus=Lus10006422.g ID=Lus10006422.BGIv1.0 annot-version=v1.0 MDRQGQKLAGRLLQLTLFAFAVMAFFTGYIMGSFHTVFLIYGGGLFLAALIVLPNWPFSGNPPPQPPAATRAKQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G40042			Microsomal signal peptidase 12...		Lus10006422 [exp]	0	1
AT3G22142			Bifunctional inhibitor/lipid-t...		Lus10003801 [exp]	3.0	0.8578
AT2G28790			Pathogenesis-related thaumatin...		Lus10004954 [exp]	3.0	0.8761
AT1G72020			unknown protein		Lus10006080 [exp]	6.2	0.7978
AT4G34460		ELK4, AGB1, ATA...	ERECTA-LIKE 4, GTP binding pro...		Lus10040464 [exp]	9.2	0.8031
AT3G22680		RDM1	RNA-DIRECTED DNA METHYLATION 1...		Lus10006598 [exp]	15.0	0.7597
					Lus10010480 [exp]	16.8	0.8661
AT4G24470	GATA	GATA25, TIFY1, ...	Zinc-finger protein expressed ...		Lus10032839 [exp]	19.3	0.7970
AT2G21060		ATCSP4, ATGRP2B	COLD SHOCK DOMAIN PROTEIN 4, g...		Lus10034487 [exp]	19.4	0.8321
AT2G21060		ATCSP4, ATGRP2B	COLD SHOCK DOMAIN PROTEIN 4, g...		Lus10025058 [exp]	20.5	0.8256
AT5G05610	Alfin	AL1	alfin-like 1 (.1.2)		Lus10009889 [exp]	24.7	0.7763

Compare expression of checked genes

Lus10006422 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.