Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011367 [exp] 167 / 2e-55 ND / Lus10037007 [exp] 99 / 4e-28 ND / Lus10015798 [exp] 98 / 1e-27 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G058400 [exp] 96 / 1e-26 ND / Potri.008G176700 [exp] 72 / 3e-17 ND / Potri.010G058600 [exp] 48 / 4e-08 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10006424 pacid=23171951 polypeptide=Lus10006424 locus=Lus10006424.g ID=Lus10006424.BGIv1.0 annot-version=v1.0 ATGGAGGAAGAGTCAGTGGTGATGCCGAGGGCCAAGAGTTTCCGCGACGAGGACTATAACAACAGGAGGGTGTTCCTCAGGAGCTACCCGCTTCACTGGG AATCCGACAATCGAAGCGATCGGAGCGATGAAGACATGATCATCCGGCAGCCTACTGACAAGATCAGCAACGGCCAAAAGAGACCTGTGAGGAAGATGAT GGTGTCCATGTTTCAGTGGGGGGAAGGGAGGGTTCTGGTCCTGAGGAGGTTCAAGCACAAGGTGTCGGTTTACGTAGTGAGTTGCATCCCGATTTCTGGA TATAGGAGTTCTTCTCGGGTAATGATTTCGGGTTGA
AA sequence Show only first row Show all	>Lus10006424 pacid=23171951 polypeptide=Lus10006424 locus=Lus10006424.g ID=Lus10006424.BGIv1.0 annot-version=v1.0 MEEESVVMPRAKSFRDEDYNNRRVFLRSYPLHWESDNRSDRSDEDMIIRQPTDKISNGQKRPVRKMMVSMFQWGEGRVLVLRRFKHKVSVYVVSCIPISG YRSSSRVMISG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10006424 [exp]	0	1
AT3G24620		ATROPGEF8, ROPG...	RHO guanyl-nucleotide exchange...		Lus10034927 [exp]	5.3	0.6315
AT5G25120		CYP71B11	"ytochrome p450, family 71, su...		Lus10004408 [exp]	5.4	0.6544
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10003847 [exp]	9.8	0.5628
AT5G28690			Protein of unknown function (D...		Lus10005536 [exp]	11.2	0.5046
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10019779 [exp]	12.7	0.4933
AT5G45840			Leucine-rich repeat protein ki...		Lus10007281 [exp]	15.2	0.5196
AT4G35420		TKPR1, DRL1	tetraketide alpha-pyrone reduc...		Lus10006141 [exp]	22.6	0.5033
AT2G20710			Tetratricopeptide repeat (TPR)...		Lus10029335 [exp]	22.7	0.4812
AT2G33530		SCPL46	serine carboxypeptidase-like 4...		Lus10023447 [exp]	25.2	0.4726
AT2G38430			unknown protein		Lus10030356 [exp]	28.1	0.4925

Compare expression of checked genes

Lus10006424 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.