Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT1G13060 446 / 2e-160 PBE1 20S proteasome beta subunit E1 (.1.2) AT4G31300 92 / 4e-22 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT5G40580 87 / 9e-20 PBB2 20S proteasome beta subunit PBB2 (.1.2.3) AT3G27430 85 / 2e-19 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT3G14290 70 / 6e-14 PAE2 20S proteasome alpha subunit E2 (.1) AT1G53850 69 / 1e-13 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT1G77440 65 / 2e-12 PBC2 20S proteasome beta subunit C2 (.1.2) AT1G21720 63 / 1e-11 PBC1 proteasome beta subunit C1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011369 [exp] 545 / 0 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10014581 [exp] 89 / 2e-20 AT5G40580 471 / 2e-169 20S proteasome beta subunit PBB2 (.1.2.3) Lus10020180 [exp] 88 / 2e-20 AT4G31300 429 / 7e-155 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10032102 [exp] 87 / 1e-19 AT3G27430 473 / 6e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10026984 [exp] 85 / 1e-18 AT4G31300 357 / 2e-124 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10037454 [exp] 70 / 3e-13 AT1G53850 464 / 8e-163 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10003936 [exp] 70 / 4e-13 AT1G53850 463 / 9e-162 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10004885 [exp] 63 / 1e-11 AT1G21720 356 / 2e-127 proteasome beta subunit C1 (.1) Lus10020599 [exp] 62 / 3e-11 AT1G21720 355 / 7e-127 proteasome beta subunit C1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G177000 [exp] 469 / 3e-169 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.010G058100 [exp] 457 / 9e-165 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.006G077900 [exp] 91 / 2e-21 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.018G145900 [exp] 87 / 4e-20 AT4G31300 405 / 3e-145 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.017G071100 [exp] 82 / 3e-18 AT5G40580 497 / 1e-180 20S proteasome beta subunit PBB2 (.1.2.3) Potri.004G066000 [exp] 82 / 3e-18 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.001G162900 [exp] 72 / 1e-14 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1) Potri.003G072500 [exp] 71 / 3e-14 AT3G14290 464 / 1e-168 20S proteasome alpha subunit E2 (.1) Potri.002G080800 [exp] 63 / 1e-11 AT1G21720 383 / 1e-137 proteasome beta subunit C1 (.1) Potri.005G180500 [exp] 61 / 5e-11 AT1G21720 391 / 9e-141 proteasome beta subunit C1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [flax] [poplar] NTN PF00227 [flax] [poplar] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Lus10006426 pacid=23172006 polypeptide=Lus10006426 locus=Lus10006426.g ID=Lus10006426.BGIv1.0 annot-version=v1.0 ATGAATATTGATTTTAGTGGACTTGAGAATGGTCCGTCGTTGTTTGGCGCTGAAAGCCAAATGGCCGATGGATTCGCTGCTGCGCCTGGCTTCGACCTTC CCACAACTCTTGATTTTGATGGTTTCCAGAAGGAGGCTATACAGATGGTGAAGCCAGCCAAGGGTACAACCACACTGGCTTTTATCTTCAAGGAAGGTGT CATGGTGGCTGCTGATTCACGAGCCAGCATGGGAGGCTACATCTCTTCTCAATCTGTGAAGAAGATCATTGAGATCAACCCATATATGCTGGGAACAATG GCTGGTGGAGCTGCCGATTGCCAGTTCTGGCACAGGAATCTTGGCATGAAGTGCCGCTTGCACGAGTTGGCAAACAAGAGGAGGATATCAGTCACCGGAG CATCAAAGCTCTTGGCCAACATTCTCTACTCCTACCGTGGAATGGGTCTCTCAGTTGGGACCATGATTGCTGGATGGGATGAAACGGGTCCCGGTCTGTA CTACGTCGACAGTGAAGGAGGAAGGCTTAAAGGACCAAAATTCTCCGTGGGATCCGGTTCCCCTTATGCTTATGGGGTACTGGACAACGAGTACCGTTTT GACATGACGATCCCAGAAGCTGCTGAGCTAGCTAGGAGAGCCATTTATCACGCCACGTTCCGTGACGGAGCCAGTGGTGGTGTCGCCAGCGTTTACTATG TCGGACCTGACGGATGGAAGAAGTTGTCGGGAGATGATGTGGGTGACCTGCACTATATGTATAACCCAGTTGCGCCGAGCACGGTGGAGCAGGAGATGGG GGAGGTTTCTGCAGCTTGA
AA sequence Show only first row Show all	>Lus10006426 pacid=23172006 polypeptide=Lus10006426 locus=Lus10006426.g ID=Lus10006426.BGIv1.0 annot-version=v1.0 MNIDFSGLENGPSLFGAESQMADGFAAAPGFDLPTTLDFDGFQKEAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTM AGGAADCQFWHRNLGMKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGPKFSVGSGSPYAYGVLDNEYRF DMTIPEAAELARRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVGDLHYMYNPVAPSTVEQEMGEVSAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26340			N-terminal nucleophile aminohy...		Lus10006426 [exp]	0	1
AT3G26340			N-terminal nucleophile aminohy...		Lus10011369 [exp]	1.0	0.9557
AT4G00860		AT0ZI1, ATOZI1	Arabidopsis thaliana ozone-ind...		Lus10007542 [exp]	2.8	0.9444
AT3G22110		PAC1	20S proteasome alpha subunit C...		Lus10004235 [exp]	3.5	0.9390
AT1G49230			RING/U-box superfamily protein...		Lus10020859 [exp]	5.9	0.9359
AT3G53580			diaminopimelate epimerase fami...		Lus10025303 [exp]	6.2	0.9397
AT2G20420			ATP citrate lyase (ACL) family...		Lus10008238 [exp]	7.7	0.9350
AT4G13870		WRNEXO, ATWRNEX...	Werner syndrome-like exonuclea...		Lus10039164 [exp]	8.4	0.9324
AT4G30010			unknown protein		Lus10001443 [exp]	10.0	0.9135
AT1G19580		GAMMACA1 ,GAMMA...	gamma carbonic anhydrase 1 (.1...		Lus10028321 [exp]	10.2	0.9208
AT3G05500			Rubber elongation factor prote...		Lus10020648 [exp]	10.4	0.9146

Compare expression of checked genes

Lus10006426 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.