Lus10006431 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24340 99 / 4e-25 EMB260, EMB2421 EMBRYO DEFECTIVE 260, EMBRYO DEFECTIVE 2421, FAD/NAD(P)-binding oxidoreductase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011372 166 / 4e-49 AT1G24340 909 / 0.0 EMBRYO DEFECTIVE 260, EMBRYO DEFECTIVE 2421, FAD/NAD(P)-binding oxidoreductase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G178400 110 / 6e-29 AT1G24340 967 / 0.0 EMBRYO DEFECTIVE 260, EMBRYO DEFECTIVE 2421, FAD/NAD(P)-binding oxidoreductase family protein (.1)
PFAM info
Representative CDS sequence
>Lus10006431 pacid=23172004 polypeptide=Lus10006431 locus=Lus10006431.g ID=Lus10006431.BGIv1.0 annot-version=v1.0
ATGAAGGAAAGAGTCTCCAACTCCAGTTTCCTGCAGAGGATCTTGGTTTTCGGTACTGCATTTCCTCCTCGAACGTTCGAGTTTTGTGATAACAAATCAG
TTTCCGAGTTTGTTTTGCTTAACCCATACCGGTCTTTCAGGTACCTTCAAAGAGCAGTAATTTCCAATAGCAACGGTGCTAATCCGACCACAGAACCACC
TAGCGGTCGAAGAAAGGAGTATGTTCCTTTTGCAGATCCAGGATGCAGGCTGCCTCATATGTACATACGCCAATTGTCAAATCCGTCAAGCAAGGCGGCT
CTTTCAACGCTCGATCTTGTACCAGTGGACAAGCTGGAGTTCCTTCTAATGGTGGGACCTCATGACGAATCCTACAAACTTGCCCGAGGCGCATTCGAGG
TAGCAGACTAG
AA sequence
>Lus10006431 pacid=23172004 polypeptide=Lus10006431 locus=Lus10006431.g ID=Lus10006431.BGIv1.0 annot-version=v1.0
MKERVSNSSFLQRILVFGTAFPPRTFEFCDNKSVSEFVLLNPYRSFRYLQRAVISNSNGANPTTEPPSGRRKEYVPFADPGCRLPHMYIRQLSNPSSKAA
LSTLDLVPVDKLEFLLMVGPHDESYKLARGAFEVAD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G24340 EMB260, EMB2421 EMBRYO DEFECTIVE 260, EMBRYO D... Lus10006431 0 1
AT3G51070 S-adenosyl-L-methionine-depend... Lus10041804 9.4 0.6294
AT3G24490 Trihelix Alcohol dehydrogenase transcri... Lus10014730 9.9 0.6681
Lus10007903 13.4 0.6593
AT3G42150 unknown protein Lus10031451 16.7 0.6344
AT1G20510 OPCL1 OPC-8:0 CoA ligase1 (.1.2) Lus10038667 18.0 0.6242
AT2G31100 alpha/beta-Hydrolases superfam... Lus10000983 21.8 0.6066
Lus10035514 42.2 0.5386
AT1G31860 HISN2, AT-IE HISTIDINE BIOSYNTHESIS 2, hist... Lus10043483 48.1 0.5695
AT4G30200 VEL1, VIL2 VIN3-Like 2, vernalization5/VI... Lus10040339 62.2 0.5379
AT5G48140 Pectin lyase-like superfamily ... Lus10039154 68.0 0.5071

Lus10006431 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.