Lus10006432 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67600 241 / 1e-82 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT1G24350 233 / 1e-79 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
AT3G21610 189 / 5e-62 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
AT3G61770 128 / 1e-36 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT3G12685 89 / 2e-22 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011373 310 / 6e-110 AT1G67600 245 / 2e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10036984 215 / 4e-73 AT1G24350 185 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
Lus10035299 183 / 3e-59 AT3G21610 275 / 1e-95 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10000883 178 / 1e-57 AT3G21610 224 / 3e-76 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10003670 177 / 5e-57 AT3G21610 219 / 1e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10030025 167 / 1e-52 AT3G21610 243 / 6e-82 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10030253 127 / 5e-38 AT3G61770 245 / 5e-83 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001756 74 / 4e-16 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001841 74 / 5e-16 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G056600 262 / 1e-90 AT1G67600 254 / 8e-88 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.011G087100 192 / 2e-63 AT3G21610 204 / 9e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.014G156000 177 / 4e-57 AT3G21610 184 / 5e-60 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G226900 171 / 5e-55 AT3G21610 218 / 2e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G171300 135 / 2e-39 AT3G61770 331 / 3e-114 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.010G176100 67 / 2e-13 AT3G12685 193 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0525 pap2 PF02681 DUF212 Divergent PAP2 family
Representative CDS sequence
>Lus10006432 pacid=23171996 polypeptide=Lus10006432 locus=Lus10006432.g ID=Lus10006432.BGIv1.0 annot-version=v1.0
ATGGGGGATCAGAGCGCTGATGGTTCTTCTTCTTATTCTTCTTCGTCGTCGATTTTCACTAACTATCCTCTGATAGCTGCACTTGTCGCGTTCGCCGTCG
CGCAATCTATCAAGTTCTTCACCACCTGGTATAAAGAAAATCGATGGGATTTAAAGCAGTTCATTGGATCCGGTGGGATGCCTTCTTCCCATTCGTCCAC
TGTTTGTGCACTTGCCATGAGCATCGGGTTCCAGGAAGGCTTTGGAGGATCACTTTTCGCAGCTGCGTTGATCTTATCATGCATTGTGATGTATGATGCT
ACTGGTGTAAGACTTCAGGCTGGACGCCAAGCCGAGGTATTGAATCAAATTGTATACGAACTGCCTGCTGACCATCCTTTGGCTGAGAGCATACCTCTTC
GCGAGCTTCTCGGTCACACTCCGGCTCAGGTCATCGCCGGTAGTTTACTTGGAGTAGTCACGGCTATCATTGGCCACCTGATCACAATGACTACTAGTCA
AAGTTGA
AA sequence
>Lus10006432 pacid=23171996 polypeptide=Lus10006432 locus=Lus10006432.g ID=Lus10006432.BGIv1.0 annot-version=v1.0
MGDQSADGSSSYSSSSSIFTNYPLIAALVAFAVAQSIKFFTTWYKENRWDLKQFIGSGGMPSSHSSTVCALAMSIGFQEGFGGSLFAAALILSCIVMYDA
TGVRLQAGRQAEVLNQIVYELPADHPLAESIPLRELLGHTPAQVIAGSLLGVVTAIIGHLITMTTSQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G67600 Acid phosphatase/vanadium-depe... Lus10006432 0 1
AT3G47420 AtG3Pp1, ATPS3 Glycerol-3-phosphate permease ... Lus10038923 1.7 0.9139
AT3G47420 AtG3Pp1, ATPS3 Glycerol-3-phosphate permease ... Lus10027211 2.4 0.9017
Lus10032068 2.4 0.8720
AT3G02040 AtGDPD1, SRG3 Glycerophosphodiester phosphod... Lus10012556 5.9 0.8567
AT1G03350 BSD domain-containing protein ... Lus10042670 6.3 0.8696
AT2G26660 ATSPX2 ARABIDOPSIS THALIANA SPX DOMAI... Lus10002908 7.1 0.8623
AT1G67600 Acid phosphatase/vanadium-depe... Lus10011373 9.5 0.8585
AT3G27250 unknown protein Lus10032077 11.0 0.8457
Lus10017659 12.0 0.7855
AT3G08890 Protein of unknown function, D... Lus10002862 14.0 0.8127

Lus10006432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.