Lus10006458 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020204 127 / 6e-39 ND /
Lus10001729 92 / 4e-22 AT5G55390 622 / 0.0 ENHANCED DOWNY MILDEW 2 (.1.2)
Lus10002269 83 / 5e-20 AT5G55390 174 / 8e-50 ENHANCED DOWNY MILDEW 2 (.1.2)
Lus10021139 44 / 4e-06 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10006458 pacid=23171998 polypeptide=Lus10006458 locus=Lus10006458.g ID=Lus10006458.BGIv1.0 annot-version=v1.0
ATGCAGGCACTTGAAAACATCATGTGTAAAAACTGTCTATATAAGATGTATCAGTGCGGTAGACTTGGTTCTTCTGCCAAATCTCCAAGCCAAGAGGATG
AAGAAGCTGATGGAAGACTCGGCTCTGCTGAGTATGAGAAAGAGAAGGCCATGATTTTGGACAGAGCCCGTAAGGCTGGACATCACCACCGGATTCGCCA
AGTCTCTCATGTTTGGACACATCGAGAACTATGTCCAGTCCAGGCTGTTCGTACCGCTAAAGAATCTCGAGATAACAACGGCAGTATTGACGAAGCTCTT
GCTGTTTCCCCAAGAGATACTCTGACCACTCTATACCAATGGGAGAAACAGGGGGAACCTGGGATTGTGGCAGTTGGAAGTAGCTTTCCATTTGCTTGCT
TCTTAGGTTTCAATGCTGTTCAGAAAGAACAGCCGGAGTTGGAGACAGTAAGGATGTCCGGTTAA
AA sequence
>Lus10006458 pacid=23171998 polypeptide=Lus10006458 locus=Lus10006458.g ID=Lus10006458.BGIv1.0 annot-version=v1.0
MQALENIMCKNCLYKMYQCGRLGSSAKSPSQEDEEADGRLGSAEYEKEKAMILDRARKAGHHHRIRQVSHVWTHRELCPVQAVRTAKESRDNNGSIDEAL
AVSPRDTLTTLYQWEKQGEPGIVAVGSSFPFACFLGFNAVQKEQPELETVRMSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10006458 0 1
AT3G27970 Exonuclease family protein (.1... Lus10022230 1.0 0.9071
AT5G67240 SDN3 small RNA degrading nuclease 3... Lus10011505 1.4 0.7774
AT4G33270 AtCDC20.1, CDC2... cell division cycle 20.1, Tran... Lus10043009 4.0 0.7651
AT5G15740 RRT1 O-fucosyltransferase family pr... Lus10026685 7.7 0.7227
AT5G47840 AMK2 adenosine monophosphate kinase... Lus10009477 11.5 0.7712
Lus10002415 15.8 0.6724
Lus10024749 29.0 0.6822
AT1G19250 FMO1 flavin-dependent monooxygenase... Lus10014439 43.4 0.6918
AT2G30530 unknown protein Lus10034444 48.9 0.6911
Lus10021106 64.8 0.6545

Lus10006458 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.